Result : Q98E33
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0434 protein msl4429 |
| NCBI Accession ID | BA000012.4 |
| Organism | Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) |
| Left | 3512020 |
| Right | 3512265 |
| Strand | - |
| Nucleotide Sequence | ATGGCGGCGGATGGGCGTGACGGAAAGAAGATCGATGTCGATCCCAAGCTGCTGGAGCTTTTGGCCTGCCCGCTGACCAAGGGGCCGCTGGCCTGGGATCCAGAGCGCGGCGAACTGATCTCGCGGGTCGCCAAGCTCGCCTATCCTGTGCGCGACGGCATCCCGATCATGCTGCCCTCCGAGGCGCGGACGCTGTCGGCGGAAGATGTGCTGGCGCCGCCGCCGAGGCTGAGCGGGCCGGCCTGA |
| Sequence | MAADGRDGKKIDVDPKLLELLACPLTKGPLAWDPERGELISRVAKLAYPVRDGIPIMLPSEARTLSAEDVLAPPPRLSGPA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01066. Profile Description: Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C-terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. |
| Pubmed ID | 11214968 |
| Domain | CDD:412721 |
| Functional Category | Others |
| Uniprot ID | Q98E33 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3512020 | 3512265 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 2 | 963162 | 963407 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 3 | 986170 | 986412 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 4 | 2793036 | 2793278 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 5 | 993273 | 993512 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 6 | 778404 | 778646 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 7 | 1027794 | 1028033 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 8 | 6099695 | 6099934 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 9 | 3537097 | 3537306 | + | NZ_CP027666.1 | Ottowia oryzae |
| 10 | 363869 | 364093 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 11 | 361840 | 362091 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 12 | 578668 | 578865 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 13 | 386595 | 386795 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 14 | 2731735 | 2731935 | + | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 15 | 2822827 | 2823027 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 16 | 772333 | 772557 | - | NZ_CP061004.1 | Agrobacterium tumefaciens |
| 17 | 953583 | 953786 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 18 | 2430997 | 2431212 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 19 | 5726359 | 5726574 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 20 | 2219090 | 2219302 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 21 | 1880384 | 1880581 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 22 | 3582810 | 3583007 | - | NZ_CP013107.1 | Sinorhizobium americanum |
| 23 | 1695756 | 1695965 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 24 | 1955762 | 1955962 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 25 | 1325975 | 1326172 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 26 | 1896498 | 1896695 | - | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 27 | 1718686 | 1718883 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 28 | 1991259 | 1991456 | - | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 29 | 1775305 | 1775502 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 30 | 3602421 | 3602651 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 31 | 1811438 | 1811635 | - | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 32 | 1757963 | 1758160 | - | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 33 | 4082669 | 4082872 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 34 | 3922743 | 3922940 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 35 | 1679162 | 1679359 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 36 | 1686541 | 1686759 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 37 | 1704982 | 1705215 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 38 | 1161432 | 1161629 | + | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 39 | 3736596 | 3736802 | + | NZ_CP016171.1 | Bordetella bronchialis |
| 40 | 1625793 | 1626008 | + | NZ_CP031325.1 | Neisseria polysaccharea |
| 41 | 985231 | 985428 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 42 | 1132212 | 1132421 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 43 | 1301209 | 1301418 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 44 | 3995509 | 3995727 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
++ More..