Result : Q97SE5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AE005672.3 |
| Organism | Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) |
| Left | 411927 |
| Right | 412229 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTACGCAAGAAGAGGTAACACACGTTGCCAATCTTTCAAAATTAAGATTCTCTGAAGAAGAAACTGCTGCCTTTGCGACCACCTTGTCTAAGATTGTTGACATGGTTGAATTGCTGGGCGAAGTTGACACAACTGGTGTCGCACCTACTACGACTATGGCTGACCGCAAGACTGTACTCCGCCCTGATGTGGCCGAAGAAGGAATAGACCGTGATCGCTTGTTTAAAAACGTACCTGAAAAAGACAACTACTATATCAAGGTGCCAGCTATCCTAGACAATGGAGGAGATGCCTAA |
| Sequence | MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 11463916 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q97SE5 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 210876 | 211178 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 2 | 485771 | 486073 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 3 | 361109 | 361411 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 4 | 1563778 | 1564080 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 5 | 1595108 | 1595410 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 6 | 1043286 | 1043588 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 7 | 433770 | 434072 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 8 | 976412 | 976714 | + | NZ_LR134293.1 | Streptococcus canis |
| 9 | 1405490 | 1405792 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 10 | 415428 | 415730 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 11 | 768041 | 768343 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 12 | 1638173 | 1638475 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 13 | 1782189 | 1782491 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 14 | 1182822 | 1183124 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 15 | 1764670 | 1764972 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 16 | 207739 | 208041 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 17 | 1592587 | 1592889 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 18 | 1552807 | 1553109 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 19 | 527493 | 527795 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 20 | 1634179 | 1634481 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 21 | 341668 | 341970 | + | NC_012924.1 | Streptococcus suis SC84 |
| 22 | 330444 | 330746 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 23 | 100673 | 100975 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 24 | 1468288 | 1468590 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 25 | 1538378 | 1538680 | - | NZ_LS483343.1 | Streptococcus ferus |
| 26 | 200935 | 201237 | + | NZ_LT906439.1 | Streptococcus merionis |
| 27 | 1187848 | 1188150 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 28 | 1458320 | 1458622 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 29 | 1461211 | 1461474 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 30 | 1684175 | 1684477 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 31 | 471365 | 471667 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 32 | 1606042 | 1606344 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 33 | 1517456 | 1517719 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 34 | 1918460 | 1918762 | + | NZ_CP013237.1 | Streptococcus mutans |
| 35 | 981036 | 981338 | + | NZ_CP043405.1 | Streptococcus ratti |
| 36 | 340929 | 341231 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 37 | 2284077 | 2284340 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 38 | 151945 | 152208 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 39 | 959814 | 960119 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 40 | 1428715 | 1429020 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 41 | 344169 | 344432 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 42 | 1335572 | 1335865 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 43 | 1611744 | 1612049 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 44 | 1857281 | 1857586 | + | NZ_CP023011.2 | Enterococcus hirae |
| 45 | 759939 | 760244 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 46 | 1615540 | 1615845 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 47 | 1096575 | 1096880 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 48 | 1174029 | 1174334 | + | NZ_CP065211.1 | Enterococcus lactis |
| 49 | 1113430 | 1113735 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 50 | 334609 | 334911 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 51 | 902575 | 902880 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 52 | 1849390 | 1849683 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 53 | 285578 | 285871 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 54 | 3781325 | 3781630 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 55 | 1817540 | 1817845 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 56 | 1768569 | 1768874 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 57 | 1433949 | 1434254 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 58 | 1356707 | 1357006 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 59 | 231910 | 232173 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 60 | 2399276 | 2399581 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 61 | 2033740 | 2034045 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 62 | 979487 | 979792 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 63 | 1476853 | 1477155 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 64 | 1167440 | 1167745 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 65 | 1056466 | 1056771 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 66 | 4095473 | 4095760 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 67 | 649993 | 650280 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032621.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 1.0 | 67 | 1466 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 1.0 | 67 | 1466 | same-strand | GatB domain |
| 3 | PF01425.23 | 1.0 | 67 | 0.0 | same-strand | Amidase |
++ More..