Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AE001437.1 |
Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
Left | 2183043 |
Right | 2183276 |
Strand | - |
Nucleotide Sequence | ATGCCTTCTAAAAAAGAAAGTTATGAATCAATGATAAAAGAACTTGAAAAAATTGTGAGCAGTATGGAAAATGAAGAGTTACCTTTAGAGGAAGCTATGAAAAATTATGAGGATGGTGTAAAGCTTTGTGATAAGCTGTATAAAATATTAAACAAAGCGGAGGGAAAGATAAAACTGCTTACGGAAAATGGAGAAGAGGAATTTAAAAAAGCAGGTGATTCATATGAACAATAA |
Sequence | MPSKKESYESMIKELEKIVSSMENEELPLEEAMKNYEDGVKLCDKLYKILNKAEGKIKLLTENGEEEFKKAGDSYEQ |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000250}. |
Pubmed ID | 11466286 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q97HD1 |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2184638 | 2184871 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
2 | 3460594 | 3460818 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
3 | 1215220 | 1215444 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
4 | 2045204 | 2045425 | + | NZ_CP013019.1 | Clostridium pasteurianum |
5 | 235486 | 235689 | + | NZ_CP026606.1 | Methanococcus maripaludis |
6 | 5682042 | 5682260 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
7 | 2087365 | 2087580 | - | NZ_CP011663.1 | Clostridium sporogenes |
8 | 990987 | 991205 | + | NZ_CP020953.1 | Clostridium drakei |
9 | 3331329 | 3331547 | - | NZ_CP009933.1 | Clostridium scatologenes |
10 | 1268104 | 1268322 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
11 | 2978983 | 2979204 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
12 | 1943752 | 1943964 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
13 | 1861918 | 1862127 | - | NZ_CP032416.1 | Clostridium fermenticellae |
14 | 1328916 | 1329143 | - | NZ_LT906477.1 | Clostridium cochlearium |
15 | 1621478 | 1621681 | - | NC_009634.1 | Methanococcus vannielii SB |
16 | 2016681 | 2016896 | - | NZ_CP028842.1 | Clostridium botulinum |
17 | 1221102 | 1221326 | + | NZ_LR590481.1 | Hathewaya histolytica |
18 | 2586142 | 2586366 | - | NZ_CP014176.1 | Clostridium argentinense |
19 | 2038894 | 2039118 | - | NZ_CP017253.2 | Clostridium taeniosporum |
20 | 1534505 | 1534729 | + | NZ_CP040924.1 | Clostridium thermarum |
21 | 2314266 | 2314460 | + | NC_014393.1 | Clostridium cellulovorans 743B |
22 | 863292 | 863489 | + | NZ_CP016786.1 | Clostridium isatidis |
23 | 2972638 | 2972835 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
24 | 2301816 | 2302013 | - | NZ_CP030775.1 | Clostridium butyricum |
25 | 1847892 | 1848089 | + | NZ_CP043998.1 | Clostridium diolis |
26 | 1181414 | 1181635 | + | NC_008593.1 | Clostridium novyi NT |
27 | 3334526 | 3334744 | - | NZ_CP041660.1 | Catenovulum sediminis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF20143.1 | 0.89 | 24 | 3800.5 | same-strand | ATP-NAD kinase C-terminal domain |
2 | PF01728.21 | 0.89 | 24 | 2958.0 | same-strand | FtsJ-like methyltransferase |
3 | PF01479.27 | 0.81 | 22 | 2923.5 | same-strand | S4 domain |
4 | PF13292.8 | 0.93 | 25 | 1070 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
5 | PF02779.26 | 0.93 | 25 | 1070 | same-strand | Transketolase, pyrimidine binding domain |
6 | PF02780.22 | 0.93 | 25 | 1070 | same-strand | Transketolase, C-terminal domain |
7 | PF00348.19 | 0.93 | 25 | 22 | same-strand | Polyprenyl synthetase |
8 | PF13742.8 | 0.96 | 26 | 26.5 | same-strand | OB-fold nucleic acid binding domain |
9 | PF01336.27 | 0.96 | 26 | 26.5 | same-strand | OB-fold nucleic acid binding domain |
10 | PF01029.20 | 0.89 | 24 | 2074.0 | same-strand | NusB family |
11 | PF03780.15 | 0.89 | 24 | 2595.5 | same-strand | Asp23 family, cell envelope-related function |