Result : Q97EX7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C 2 (Glu-ADT subunit C 2) (EC 6.3.5.-) |
| NCBI Accession ID | AE001437.1 |
| Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Left | 3114382 |
| Right | 3114675 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGATAAACATGTTGATATAGATACTGTTAAGTATATTTCAAAGCTTTCAAAGCTTAAGTTTACAGACAATGAAGCTAAAAAACTTGCAGGAGAATTTGAAGCAATACTTGGGCATTTTGAAACAATAGATAAGGTTGATTTATCTGATATAAATGTAAATGAATTTGATGAGGTAAACACAGAATTTAGAAAAGATGTTCCTAAGGTTTTTGAAGATAAAAAGAAGCTTATGCAAAATGTTAAGAGTTTAAGAGATGGTGCGATAGAGGTGCCTAAGATAATAGAGTAG |
| Sequence | MSDKHVDIDTVKYISKLSKLKFTDNEAKKLAGEFEAILGHFETIDKVDLSDINVNEFDEVNTEFRKDVPKVFEDKKKLMQNVKSLRDGAIEVPKIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity). {ECO:0000250}. |
| Pubmed ID | 11466286 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q97EX7 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3116009 | 3116302 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 2 | 189916 | 190152 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 3 | 3809188 | 3809472 | - | NZ_CP020953.1 | Clostridium drakei |
| 4 | 2974233 | 2974517 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 5 | 355340 | 355624 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 6 | 1772836 | 1773120 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 7 | 2405009 | 2405296 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 8 | 332239 | 332523 | + | NZ_CP016786.1 | Clostridium isatidis |
| 9 | 283061 | 283342 | + | NZ_HG917868.1 | Clostridium bornimense |
| 10 | 2354506 | 2354790 | + | NZ_CP043998.1 | Clostridium diolis |
| 11 | 2225149 | 2225427 | - | NZ_CP030775.1 | Clostridium butyricum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015687.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 1.0 | 11 | 1493 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 1.0 | 11 | 1493 | same-strand | GatB domain |
| 3 | PF01425.23 | 1.0 | 11 | 16 | same-strand | Amidase |
| 4 | PF00152.22 | 0.91 | 10 | 65.0 | same-strand | tRNA synthetases class II (D, K and N) |
| 5 | PF01336.27 | 0.91 | 10 | 65.0 | same-strand | OB-fold nucleic acid binding domain |
++ More..