| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative ribosomal protein L7Ae-like |
| NCBI Accession ID | AE001437.1 |
| Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Left | 3274884 |
| Right | 3275123 |
| Strand | - |
| Nucleotide Sequence | ATGGTAAACAGGTTGCCGAAGAATAAAGTAGTAGGCATGAAACAGTCTCTTAAAGCTATAAATGAGAAAAAAGCTCAAATGGTTTATATAGCTAAAGATGCAGAAAGTGAGTTGTTTCAAACTGTTGAAAAATTGGCAAATGAACATTCTCTACAAATAGTATATGTAGATACTATGAAGGAATTAGGCAAATTATGTAATATTGATGTTGAAGCTTCAACTGCTGTAGTTTTGAAGTAA |
| Sequence | MVNRLPKNKVVGMKQSLKAINEKKAQMVYIAKDAESELFQTVEKLANEHSLQIVYVDTMKELGKLCNIDVEASTAVVLK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00600. Profile Description: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family. This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response. |
| Pubmed ID | 11466286 |
| Domain | CDD:412466 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q97EH1 |
| ORF Length (Amino Acid) | 79 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3276511 | 3276750 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 2 | 3942418 | 3942657 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 3 | 2083659 | 2083901 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 4 | 4450889 | 4451131 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 5 | 208220 | 208459 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 6 | 2886691 | 2886930 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 7 | 4444336 | 4444578 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 8 | 642799 | 643035 | + | NZ_CP014176.1 | Clostridium argentinense |
| 9 | 2667457 | 2667696 | - | NZ_HG917868.1 | Clostridium bornimense |
| 10 | 261140 | 261379 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 11 | 3683476 | 3683715 | - | NZ_CP028842.1 | Clostridium botulinum |
| 12 | 3964601 | 3964840 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 13 | 4566674 | 4566916 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 14 | 3713492 | 3713737 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 15 | 5294713 | 5294955 | - | NZ_CP020953.1 | Clostridium drakei |
| 16 | 2272245 | 2272496 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 17 | 4629248 | 4629490 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 18 | 346705 | 346905 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 19 | 409588 | 409812 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 20 | 1969072 | 1969296 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 21 | 2299377 | 2299601 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 22 | 3541991 | 3542233 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 23 | 424531 | 424743 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 24 | 2262484 | 2262699 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 25 | 348353 | 348568 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 26 | 771629 | 771838 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 27 | 2904123 | 2904335 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 28 | 4231308 | 4231547 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00338.24 | 0.79 | 22 | 4859.0 | same-strand | Ribosomal protein S10p/S20e |
| 2 | PF00009.29 | 1.0 | 28 | 2207.5 | same-strand | Elongation factor Tu GTP binding domain |
| 3 | PF03143.19 | 1.0 | 28 | 3306.0 | same-strand | Elongation factor Tu C-terminal domain |
| 4 | PF03144.27 | 1.0 | 28 | 1350 | same-strand | Elongation factor Tu domain 2 |
| 5 | PF01926.25 | 1.0 | 28 | 3272.0 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF03764.20 | 1.0 | 28 | 1189.0 | same-strand | Elongation factor G, domain IV |
| 7 | PF14492.8 | 1.0 | 28 | 1189.0 | same-strand | Elongation Factor G, domain III |
| 8 | PF00679.26 | 1.0 | 28 | 1189.0 | same-strand | Elongation factor G C-terminus |
| 9 | PF00177.23 | 1.0 | 28 | 631.5 | same-strand | Ribosomal protein S7p/S5e |
| 10 | PF00164.27 | 1.0 | 28 | 81.0 | same-strand | Ribosomal protein S12/S23 |
| 11 | PF04997.14 | 1.0 | 28 | 121.0 | same-strand | RNA polymerase Rpb1, domain 1 |
| 12 | PF04998.19 | 0.86 | 24 | 118.5 | same-strand | RNA polymerase Rpb1, domain 5 |
| 13 | PF04983.20 | 1.0 | 28 | 121.0 | same-strand | RNA polymerase Rpb1, domain 3 |
| 14 | PF00562.30 | 1.0 | 28 | 3682.0 | same-strand | RNA polymerase Rpb2, domain 6 |
| 15 | PF04565.18 | 1.0 | 28 | 3682.0 | same-strand | RNA polymerase Rpb2, domain 3 |
| 16 | PF04563.17 | 1.0 | 28 | 3682.0 | same-strand | RNA polymerase beta subunit |
| 17 | PF04560.22 | 1.0 | 28 | 3682.0 | same-strand | RNA polymerase Rpb2, domain 7 |
| 18 | PF10385.11 | 1.0 | 28 | 3682.0 | same-strand | RNA polymerase beta subunit external 1 domain |
| 19 | PF00542.21 | 1.0 | 28 | 7696.5 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 20 | PF16320.7 | 1.0 | 28 | 7696.5 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
| 21 | PF00466.22 | 0.96 | 27 | 8105 | same-strand | Ribosomal protein L10 |
| 22 | PF00687.23 | 0.93 | 26 | 8800.0 | same-strand | Ribosomal protein L1p/L10e family |