Result : Q93PP8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Rubredoxin-2 (Rd-2) |
| NCBI Accession ID | AF321851.1 |
| Organism | Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) |
| Left | 832 |
| Right | 1020 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAACCGCAAGACATGTGGCGTTGCCAGATGGTAAACTGTGGCTATGTGTATGATCCCGACCGTGGCGACAAGCGCCGCAAGGTTCCTGCGGGAACCAAGTTCGAAGATCTGCCCGAAGACTGGCGTTGTCCGGTCTGTGGCGCGGGTAAAAAAAGTTTTCGCCGCCTGAGCGATGAAGCATAA |
| Sequence | MAEPQDMWRCQMVNCGYVYDPDRGDKRRKVPAGTKFEDLPEDWRCPVCGAGKKSFRRLSDEA |
| Source of smORF | Swiss-Prot |
| Function | Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule. |
| Pubmed ID | 11454214 9662435 |
| Domain | CDD:412217 |
| Functional Category | Metal-binding |
| Uniprot ID | Q93PP8 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 168
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1067397 | 1067585 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 2 | 2030218 | 2030376 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 3 | 1958633 | 1958794 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 4 | 2218146 | 2218361 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 5 | 4060648 | 4060806 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 6 | 2087947 | 2088162 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 7 | 916151 | 916309 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 8 | 1180386 | 1180601 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 9 | 1901521 | 1901679 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 10 | 1840721 | 1840924 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 11 | 2720478 | 2720639 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 12 | 5346491 | 5346670 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 13 | 5346226 | 5346387 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 14 | 876342 | 876527 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 15 | 1953896 | 1954111 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 16 | 1954255 | 1954440 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 17 | 3331253 | 3331411 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 18 | 3942234 | 3942392 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 19 | 3626074 | 3626235 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 20 | 5957006 | 5957185 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 21 | 5956686 | 5956847 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 22 | 1954754 | 1954915 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 23 | 1113921 | 1114091 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 24 | 94655 | 94834 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 25 | 3574067 | 3574246 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 26 | 3574412 | 3574573 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 27 | 2305494 | 2305655 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 28 | 748925 | 749134 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 29 | 1688974 | 1689132 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 30 | 2455713 | 2455871 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 31 | 2413203 | 2413394 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 32 | 298205 | 298384 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 33 | 2049342 | 2049500 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 34 | 3181151 | 3181309 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 35 | 1098548 | 1098706 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 36 | 3903327 | 3903482 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 37 | 2656403 | 2656564 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 38 | 3742778 | 3742933 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 39 | 1696817 | 1696978 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 40 | 4485730 | 4485909 | - | NZ_CP061799.1 | Desulfonema limicola |
| 41 | 2888278 | 2888439 | + | NZ_CP061799.1 | Desulfonema limicola |
| 42 | 1605864 | 1606022 | - | NZ_CP061799.1 | Desulfonema limicola |
| 43 | 151349 | 151555 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 44 | 1395363 | 1395524 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 45 | 893151 | 893312 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 46 | 2824946 | 2825101 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 47 | 3187578 | 3187757 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 48 | 3193884 | 3194045 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 49 | 209756 | 209932 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 50 | 434642 | 434845 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 51 | 4970881 | 4971057 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 52 | 405079 | 405231 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 53 | 1252712 | 1252909 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 54 | 889775 | 889939 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 55 | 1122886 | 1123047 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 56 | 211082 | 211258 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 57 | 1266834 | 1267034 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 58 | 1616387 | 1616551 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 59 | 243985 | 244161 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 60 | 428499 | 428660 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 61 | 603616 | 603774 | - | NC_011832.1 | Methanosphaerula palustris E1-9c |
| 62 | 2252915 | 2253118 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 63 | 2098952 | 2099113 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 64 | 1012892 | 1013053 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 65 | 2870688 | 2870879 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 66 | 2463862 | 2464017 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 67 | 1622025 | 1622177 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 68 | 1825338 | 1825502 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 69 | 570707 | 570865 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 70 | 1268338 | 1268499 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 71 | 1036968 | 1037126 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 72 | 1921796 | 1921957 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 73 | 103547 | 103708 | + | NC_000916.1 | Methanothermobacter thermautotrophicus str. Delta H |
| 74 | 103374 | 103535 | + | NC_000916.1 | Methanothermobacter thermautotrophicus str. Delta H |
| 75 | 2019493 | 2019657 | - | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 76 | 1246578 | 1246736 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 77 | 2408415 | 2408576 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 78 | 122482 | 122640 | + | NC_018227.2 | Methanoculleus bourgensis MS2 |
| 79 | 414136 | 414297 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 80 | 180980 | 181141 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 81 | 439224 | 439382 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 82 | 2139745 | 2139903 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 83 | 1713068 | 1713229 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 84 | 2452320 | 2452481 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 85 | 535169 | 535327 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 86 | 548421 | 548582 | + | NC_014408.1 | Methanothermobacter marburgensis str. Marburg |
| 87 | 548248 | 548409 | + | NC_014408.1 | Methanothermobacter marburgensis str. Marburg |
| 88 | 1683898 | 1684062 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 89 | 1718953 | 1719117 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 90 | 554254 | 554415 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 91 | 2325382 | 2325540 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 92 | 2878850 | 2879011 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 93 | 1910952 | 1911113 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 94 | 700801 | 700965 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 95 | 872403 | 872561 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 96 | 299991 | 300152 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 97 | 1257034 | 1257198 | + | NZ_CP006577.1 | Archaeoglobus fulgidus DSM 8774 |
| 98 | 827911 | 828072 | + | NZ_CP006577.1 | Archaeoglobus fulgidus DSM 8774 |
| 99 | 1431866 | 1432024 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 100 | 1312497 | 1312667 | + | NC_015574.1 | Methanobacterium paludis |
| 101 | 1315322 | 1315483 | - | NC_015574.1 | Methanobacterium paludis |
| 102 | 134323 | 134481 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 103 | 2076820 | 2076978 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 104 | 1442285 | 1442446 | + | NZ_CP011267.1 | Geoglobus ahangari |
| 105 | 860505 | 860666 | + | NC_000868.1 | Pyrococcus abyssi GE5 |
| 106 | 1825085 | 1825243 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 107 | 1789039 | 1789203 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 108 | 757509 | 757667 | + | NZ_CP014265.1 | Methanobrevibacter olleyae |
| 109 | 622698 | 622868 | - | NC_010482.1 | Candidatus Korarchaeum cryptofilum OPF8 |
| 110 | 2136469 | 2136627 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 111 | 1492176 | 1492337 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 112 | 3832334 | 3832489 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 113 | 1227527 | 1227688 | - | NZ_CP040846.1 | Thermococcus indicus |
| 114 | 44757 | 44915 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 115 | 44559 | 44717 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 116 | 1450324 | 1450485 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 117 | 44941 | 45099 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 118 | 1193902 | 1194066 | - | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 119 | 401340 | 401501 | + | NZ_CP006965.1 | Thermococcus paralvinellae |
| 120 | 1199732 | 1199893 | + | NZ_LR881183.1 | Thermococcus camini |
| 121 | 1084957 | 1085115 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 122 | 3109369 | 3109527 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 123 | 801560 | 801721 | + | NC_011529.1 | Thermococcus onnurineus NA1 |
| 124 | 1220504 | 1220662 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 125 | 1228565 | 1228726 | + | NZ_LT607756.1 | Methanobacterium congolense |
| 126 | 1103556 | 1103714 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 127 | 2099488 | 2099649 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 128 | 4505412 | 4505570 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 129 | 358128 | 358286 | + | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 130 | 2265979 | 2266176 | - | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 131 | 1308195 | 1308353 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 132 | 872732 | 872890 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 133 | 1325343 | 1325501 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 134 | 1482956 | 1483114 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 135 | 1440879 | 1441037 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 136 | 1527722 | 1527880 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 137 | 564623 | 564787 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 138 | 1171244 | 1171402 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 139 | 1279870 | 1280028 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 140 | 2139870 | 2140028 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 141 | 3448823 | 3448981 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 142 | 2705619 | 2705783 | + | NC_013665.1 | Methanocella paludicola SANAE |
| 143 | 2646733 | 2646891 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 144 | 5778182 | 5778340 | - | NZ_CP061800.1 | Desulfonema magnum |
| 145 | 1628445 | 1628606 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 146 | 1478517 | 1478678 | + | NC_017527.1 | Methanosaeta harundinacea 6Ac |
| 147 | 1216949 | 1217107 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 148 | 437768 | 437926 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 149 | 1501269 | 1501430 | + | NZ_CP015102.1 | Thermococcus pacificus |
| 150 | 1701957 | 1702118 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 151 | 1714753 | 1714914 | + | NZ_CP015103.1 | Thermococcus siculi |
| 152 | 451084 | 451245 | + | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 153 | 338972 | 339133 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 154 | 591560 | 591721 | + | NZ_CP007264.1 | Thermococcus nautili |
| 155 | 510221 | 510382 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 156 | 185165 | 185323 | - | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 157 | 2075828 | 2075992 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 158 | 1078802 | 1078960 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 159 | 1324175 | 1324339 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 160 | 57605 | 57766 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 161 | 646060 | 646224 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 162 | 541086 | 541250 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 163 | 4582273 | 4582434 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 164 | 76467 | 76625 | + | NZ_CP009228.1 | Treponema putidum |
| 165 | 462529 | 462690 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 166 | 258852 | 259013 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 167 | 256259 | 256420 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 168 | 299047 | 299208 | + | NC_014804.1 | Thermococcus barophilus MP |
| 169 | 3194202 | 3194360 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 170 | 1739561 | 1739728 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 171 | 1530397 | 1530558 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 172 | 70506 | 70670 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 173 | 90769 | 90930 | + | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 174 | 2534992 | 2535150 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 175 | 766867 | 767028 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 176 | 1410145 | 1410321 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 177 | 495988 | 496149 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 178 | 681556 | 681717 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 179 | 1764161 | 1764319 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 180 | 1111734 | 1111895 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 181 | 2268660 | 2268821 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 182 | 3569267 | 3569425 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 183 | 3217787 | 3217948 | - | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 184 | 126621 | 126782 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 185 | 1131879 | 1132043 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 186 | 1903856 | 1904017 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 187 | 1134126 | 1134284 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 188 | 2342052 | 2342210 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 189 | 2790245 | 2790403 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 190 | 489009 | 489167 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 191 | 105800 | 105958 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 192 | 859983 | 860144 | - | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 193 | 2516661 | 2516819 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 194 | 1002515 | 1002679 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 195 | 234372 | 234530 | + | NC_009051.1 | Methanoculleus marisnigri JR1 |
| 196 | 3472668 | 3472826 | - | NZ_CP036259.1 | Sporomusa termitida |
| 197 | 959646 | 959801 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 198 | 13230 | 13391 | + | NC_014634.1 | Ilyobacter polytropus DSM 2926 |
| 199 | 522287 | 522445 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 200 | 215027 | 215185 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 201 | 388148 | 388306 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 202 | 2788490 | 2788654 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 203 | 5768566 | 5768775 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 204 | 3015117 | 3015275 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 205 | 2275429 | 2275590 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 206 | 2460548 | 2460709 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 207 | 10818152 | 10818325 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 208 | 1417129 | 1417293 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 209 | 1854211 | 1854372 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 210 | 161240 | 161395 | - | NC_008942.1 | Methanocorpusculum labreanum Z |
| 211 | 9875807 | 9875971 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 212 | 1113414 | 1113572 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 213 | 3185760 | 3185915 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 214 | 533109 | 533270 | + | NC_013741.1 | Archaeoglobus profundus DSM 5631 |
| 215 | 1859512 | 1859676 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 216 | 1616602 | 1616763 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 217 | 1825581 | 1825742 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 218 | 581279 | 581437 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
++ More..