Result : Q93NB3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin epsilon |
| NCBI Accession ID | AF380336.1 |
| Organism | Lactococcus lactis subsp. lactis (Streptococcus lactis) |
| Left | 2923 |
| Right | 3186 |
| Strand | - |
| Nucleotide Sequence | ATGGCATTAGATTACAGAAAAACATTTGAAATTGAGATAATCAATGAATTTCAATCAGCGATTCACTCAAAAATGTTGAACTATGTTTTAAATAATGAACTCGATAAAAGCGATTCTACAAACCTACAAACAAATTTGCTAAATCAATTATCAAACATGAATCAAATTAATTTATTTAAATTATCTCTTGAAGAACTAGAAGCCTATCATGAATATTTACGATCAATAAAAAAATACGCCGACAGTATCACACGAACAACGTGA |
| Sequence | MALDYRKTFEIEIINEFQSAIHSKMLNYVLNNELDKSDSTNLQTNLLNQLSNMNQINLFKLSLEELEAYHEYLRSIKKYADSITRTT |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate zeta toxin. Part of a postsegregational killing (PSK) system involved in the killing of plasmid-free cells. Continuous synthesis of the epsilon antitoxin is required to counteract the zeta toxin (By similarity). {ECO:0000250}. |
| Pubmed ID | |
| Domain | CDD:370234 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q93NB3 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2269 | 2532 | + | NZ_AP022824.1 | Enterococcus saigonensis |
| 2 | 10705 | 10968 | + | NZ_AP022824.1 | Enterococcus saigonensis |
| 3 | 19145 | 19408 | + | NZ_AP022824.1 | Enterococcus saigonensis |
| 4 | 75169 | 75441 | - | NZ_AP022823.1 | Enterococcus saigonensis |
| 5 | 1249885 | 1250157 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022823.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 2 | 2633.5 | same-strand | ABC transporter |
| 2 | PF01381.24 | 1.0 | 2 | 1647.0 | same-strand | Helix-turn-helix |
| 3 | PF12844.9 | 1.0 | 2 | 1647.0 | same-strand | Helix-turn-helix domain |
| 4 | PF13443.8 | 1.0 | 2 | 1647.0 | same-strand | Cro/C1-type HTH DNA-binding domain |
| 5 | PF07764.13 | 1.0 | 2 | 18.0 | same-strand | Omega Transcriptional Repressor |
++ More..