Result : Q93HD3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Polyketide-8 synthase acyl carrier protein 1 (ACP 1) |
| NCBI Accession ID | AB070946.1 |
| Organism | Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) |
| Left | 4216 |
| Right | 4470 |
| Strand | + |
| Nucleotide Sequence | GTGACGACCGGACTTGACGCTGCCCGCAAGCAGGAGATCAAGGAGATCGTCTGCGACATTCTCGAGATCGACGAGGACGAGGTCACCGAGACCAGCCTCTTCAAGGAGCAGCACGACGCGGACTCGCTCCGCGCCATCGAGATCCTCGCCGCCCTCGAGCGCACCCAGAAGGTCACCATCGACCAGGCCGAGCTCAGCCGCATGGTCAACCTGGAGGGCGTCTACGTCGTGGTGTCCGAAGCCGCACAGAACTGA |
| Sequence | MTTGLDAARKQEIKEIVCDILEIDEDEVTETSLFKEQHDADSLRAIEILAALERTQKVTIDQAELSRMVNLEGVYVVVSEAAQN |
| Source of smORF | Swiss-Prot |
| Function | Acyl carrier protein. |
| Pubmed ID | 11572948 12692562 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q93HD3 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4540196 | 4540450 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 2 | 3641384 | 3641638 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 3 | 5605060 | 5605320 | + | NZ_CP022310.1 | Streptomyces calvus |
| 4 | 2266548 | 2266808 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 5 | 4667221 | 4667472 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 6 | 7942652 | 7942903 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 7 | 10952395 | 10952652 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 8 | 8081366 | 8081617 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 9 | 2440901 | 2441155 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 10 | 5632020 | 5632274 | + | NZ_CP027306.1 | Streptomyces atratus |
| 11 | 157105 | 157365 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 12 | 5445363 | 5445626 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 13 | 6792800 | 6793045 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 14 | 7031546 | 7031791 | + | NZ_CP070242.1 | Streptomyces californicus |
| 15 | 7074211 | 7074456 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 16 | 3779316 | 3779567 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 17 | 3429733 | 3429942 | + | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 18 | 6235601 | 6235855 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 19 | 3800203 | 3800484 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 20 | 6441382 | 6441642 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 21 | 8719803 | 8720015 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 22 | 3206702 | 3206962 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 23 | 4130823 | 4131032 | - | NZ_AP023396.1 | Nocardia wallacei |
| 24 | 6551470 | 6551688 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 25 | 4210458 | 4210706 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 26 | 7167781 | 7167987 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 27 | 199194 | 199418 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 28 | 4718471 | 4718731 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 29 | 6001196 | 6001456 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 30 | 472695 | 472907 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 31 | 5058741 | 5059001 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 32 | 4813129 | 4813389 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 33 | 3374509 | 3374724 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 34 | 5419178 | 5419417 | + | NZ_CP020563.1 | Kitasatospora albolonga |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003155.5
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12697.9 | 0.69 | 22 | 3377.5 | same-strand | Alpha/beta hydrolase family |
| 2 | PF02801.24 | 1.0 | 32 | 116.0 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 3 | PF00109.28 | 1.0 | 32 | 1207 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
++ More..