Result : Q93HC3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Polyketide-8 synthase acyl carrier protein 2 (ACP 2) |
| NCBI Accession ID | AB070946.1 |
| Organism | Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) |
| Left | 14588 |
| Right | 14851 |
| Strand | + |
| Nucleotide Sequence | ATGCCCGAGACCACCACCACCGCGCTCGACAAGGAACAGCTGCGCGAACTGGTCGCCGATGTGCTCGACCTGGATGTCGCGGAGGTCACCGACGACGCCGACTTCATGGAGGACCTGGACGTCGACTCGCTGATGGCCCTGGAGATCACCGTGCGGCTGGAGAAGGAATACGGGGTACGGCTCGCCGAGGCCGAGCTGACCTCGATCACCTCGCTGCAGGGCACGTACGAACTGCTGACGAGCAAGCTCGGGGACACCCGATGA |
| Sequence | MPETTTTALDKEQLRELVADVLDLDVAEVTDDADFMEDLDVDSLMALEITVRLEKEYGVRLAEAELTSITSLQGTYELLTSKLGDTR |
| Source of smORF | Swiss-Prot |
| Function | Acyl carrier protein. |
| Pubmed ID | 11572948 12692562 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q93HC3 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4529815 | 4530078 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 2 | 3653264 | 3653530 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 3 | 2432894 | 2433112 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 4 | 5638913 | 5639152 | + | NZ_CP027306.1 | Streptomyces atratus |
| 5 | 7043626 | 7043886 | + | NZ_CP070242.1 | Streptomyces californicus |
| 6 | 7086291 | 7086551 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 7 | 8094470 | 8094724 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 8 | 6804870 | 6805130 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 9 | 831898 | 832119 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 10 | 6248282 | 6248503 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 11 | 6991462 | 6991731 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 12 | 2641564 | 2641821 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 13 | 145203 | 145445 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 14 | 7949299 | 7949529 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 15 | 4655388 | 4655615 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 16 | 7319179 | 7319469 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003155.5
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01323.22 | 0.67 | 10 | 1699 | same-strand | DSBA-like thioredoxin domain |
| 2 | PF13561.8 | 1.0 | 15 | 948 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 3 | PF00106.27 | 1.0 | 15 | 948.0 | same-strand | short chain dehydrogenase |
| 4 | PF08659.12 | 1.0 | 15 | 946.0 | same-strand | KR domain |
| 5 | PF07977.15 | 0.73 | 11 | 389.5 | same-strand | FabA-like domain |
| 6 | PF00109.28 | 0.93 | 14 | 1031.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
++ More..