Result : Q93GP6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0401 protein YubL |
| NCBI Accession ID | AE006471.2 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 54968 |
| Right | 55210 |
| Strand | + |
| Nucleotide Sequence | ATGACAGACAACATCATGAGCCCACTGAAATCCCTGCCTGATGGCACGTTCACCCACGAACAGGCCGAAGCGGTGGCAGCACAGTATCAGAATGTCGCCATTGAAGACGATCAGGGGACGCACCTTCGCTTGGTTGTGCGTAAGGACGGCGAAATGGTCTGGCGGGGCTGGAATTTTGAACCGGGCGGCGAGTACTGGCTCAACCGCTGTATCGAAAGCCACGGTATCCGTAAAACGCAGTAA |
| Sequence | MTDNIMSPLKSLPDGTFTHEQAEAVAAQYQNVAIEDDQGTHLRLVVRKDGEMVWRGWNFEPGGEYWLNRCIESHGIRKTQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam06006. Profile Description: Bacterial protein of unknown function (DUF905). This family consists of several short hypothetical Enterobacteria proteins of unknown function. Structural analysis of the surface features of the protein YvyC has revealed a single cluster of highly conserved residues on the surface. Additionally, these residues fall into two groups which lie within the two largest of the three cavities identified over the surface. The conclusion from this is that these two cavities with, Leu 58, Glu 75, Ile 82, and Glu 83 and Pro 86, conserved, are likely to be important for the molecular function and reflect the cavities found on the surface of the FlaG proteins in pfam03646. |
| Pubmed ID | 11677609 |
| Domain | CDD:368702 |
| Functional Category | Others |
| Uniprot ID | Q93GP6 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 54968 | 55210 | + | NC_003277.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 72472 | 72714 | - | NZ_CP023707.1 | Edwardsiella tarda |
| 3 | 85634 | 85876 | + | NZ_CP045204.1 | Citrobacter telavivensis |
| 4 | 67518 | 67760 | - | NZ_CP041250.1 | Raoultella electrica |
| 5 | 134873 | 135121 | - | NZ_CP065839.1 | Klebsiella quasipneumoniae |
| 6 | 95427 | 95675 | - | NZ_CP054255.1 | Klebsiella variicola |
| 7 | 91103 | 91351 | - | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 8 | 340 | 588 | - | NZ_CP026048.1 | Raoultella planticola |
| 9 | 4535233 | 4535463 | - | NZ_CP023525.1 | Cedecea neteri |
| 10 | 60188 | 60421 | - | NZ_CP028272.1 | Mixta intestinalis |
| 11 | 61324 | 61557 | - | NZ_CP017185.1 | Enterobacter roggenkampii |
| 12 | 25460 | 25693 | - | NZ_CP026049.1 | Raoultella planticola |
| 13 | 22302 | 22535 | + | NZ_CP057659.1 | Escherichia fergusonii |
| 14 | 13160 | 13408 | + | NZ_CP041249.1 | Raoultella electrica |
| 15 | 172985 | 173227 | + | NZ_CP067058.1 | Rahnella aceris |
| 16 | 958640 | 958870 | + | NZ_CP026047.1 | Raoultella planticola |
| 17 | 4934940 | 4935170 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 18 | 60966 | 61193 | - | NZ_CP050151.1 | Hafnia alvei |
| 19 | 5333787 | 5334017 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 20 | 5661081 | 5661314 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 21 | 47639 | 47872 | + | NC_002128.1 | Escherichia coli O157:H7 str. Sakai |
| 22 | 4052659 | 4052889 | - | NZ_CP050150.1 | Hafnia alvei |
| 23 | 417463 | 417696 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 1136355 | 1136579 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 25 | 1214692 | 1214925 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 26 | 44368 | 44598 | - | NZ_CP019707.1 | Pantoea alhagi |
| 27 | 3214587 | 3214826 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 28 | 265304 | 265528 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 29 | 650612 | 650851 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 30 | 1213284 | 1213523 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 31 | 464024 | 464263 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 32 | 606934 | 607173 | + | NZ_CP032487.1 | Yersinia hibernica |
| 33 | 46584 | 46799 | + | NZ_CP043319.1 | Enterobacter chengduensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003277.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03230.15 | 0.62 | 15 | 98 | same-strand | Antirestriction protein |
| 2 | PF06290.13 | 0.62 | 15 | 2113.5 | same-strand | Plasmid SOS inhibition protein (PsiB) |
++ More..