Result : Q92JR0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0007 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 6299 |
| Right | 6580 |
| Strand | - |
| Nucleotide Sequence | GTGTTACAATTAAATATTATAAGGAGGATAAAAATGACAAAAAGTATTACGACTAGTATACGCTTAGAAATAAATTTAAGTAAAAAACTTGAAAAAGCAACTTATGATTTACACCGTGAAAAAAGCTGGATAATTAGTGAAGCATATCTTAAACAACTAGAAAATTCAGACCTAGCCAAAGAAGCTAAACGTCAATCCTTATTAGCTAGTAAAGAAAACAATCCTGATGCCAACTTATGGTTAAAACACAATGAAGAAAGTTGGTTAGATGAATGGAAATAA |
| Sequence | MLQLNIIRRIKMTKSITTSIRLEINLSKKLEKATYDLHREKSWIISEAYLKQLENSDLAKEAKRQSLLASKENNPDANLWLKHNEESWLDEWK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JR0 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6299 | 6580 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 6343 | 6633 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 6335 | 6577 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 4 | 1170164 | 1170415 | + | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00085.22 | 0.75 | 3 | 4944 | opposite-strand | Thioredoxin |
| 2 | PF13098.8 | 0.75 | 3 | 4944 | opposite-strand | Thioredoxin-like domain |
| 3 | PF13899.8 | 0.75 | 3 | 4944 | opposite-strand | Thioredoxin-like |
| 4 | PF00005.29 | 0.75 | 3 | 4183 | opposite-strand | ABC transporter |
| 5 | PF01061.26 | 0.75 | 3 | 3406 | opposite-strand | ABC-2 type transporter |
| 6 | PF00132.26 | 0.75 | 3 | 778.5 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 7 | PF13720.8 | 0.75 | 3 | 31 | same-strand | Udp N-acetylglucosamine O-acyltransferase; Domain 2 |
| 8 | PF07977.15 | 0.75 | 3 | 833 | same-strand | FabA-like domain |
| 9 | PF04613.16 | 0.75 | 3 | 1466 | same-strand | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD |
| 10 | PF14602.8 | 0.75 | 3 | 1466 | same-strand | Hexapeptide repeat of succinyl-transferase |
++ More..