Result : Q92JQ1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0016 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 15379 |
| Right | 15603 |
| Strand | - |
| Nucleotide Sequence | TTGCTTGGTCTTGCAATCATGGCAATATCTTTTATATTTATGTCCTACTCCCCAAAGCCAGAATTAATATTTGATGCAAATCATATGGCGGTAGGCGTTAAAGATAGAGAAAATAAACTAGTAATACATGCTGATAAAATACCTGCTTTCAATAGAACTTACTGGGCTAATTGGTTTGGACAAAAAGATAGTATGGTGTTACCTTTAGAGAATAATATTTTTTAA |
| Sequence | MLGLAIMAISFIFMSYSPKPELIFDANHMAVGVKDRENKLVIHADKIPAFNRTYWANWFGQKDSMVLPLENNIF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JQ1 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 15379 | 15603 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 18263 | 18487 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 3 | 18571 | 18795 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 4 | 21210 | 21410 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 5 | 18495 | 18716 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01522.23 | 0.8 | 4 | 3472.0 | opposite-strand | Polysaccharide deacetylase |
| 2 | PF02367.19 | 1.0 | 5 | 2726 | same-strand | Threonylcarbamoyl adenosine biosynthesis protein TsaE |
| 3 | PF01297.19 | 1.0 | 5 | 1785 | same-strand | Zinc-uptake complex component A periplasmic |
| 4 | PF01743.22 | 1.0 | 5 | 481 | same-strand | Poly A polymerase head domain |
| 5 | PF03772.18 | 0.6 | 3 | 85 | same-strand | Competence protein |
| 6 | PF03797.21 | 1.0 | 5 | 1700 | opposite-strand | Autotransporter beta-domain |
++ More..