Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RC0022 |
NCBI Accession ID | AE006914.1 |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | 25436 |
Right | 25618 |
Strand | + |
Nucleotide Sequence | ATGGATAAATGTAGAAAGGCAAATTTATATCAAAAAATGGGTTATTATAATGAATATATATTATGTAAATTTGAAGAATCGTTAAAATATTATAAGAAAGCTTTAAAAATCGATCAAGAATTAGTTCATCCTTCTTTTATTGCTAGTTCTCTTAATAATATCGGAGTGATTTATGAAAATTAG |
Sequence | MDKCRKANLYQKMGYYNEYILCKFEESLKYYKKALKIDQELVHPSFIASSLNNIGVIYEN |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22897. Profile Description: Tetratricopeptide repeat. This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by pfam00515. |
Pubmed ID | 11557893 |
Domain | CDD:419883 |
Functional Category | Others |
Uniprot ID | Q92JP5 |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 28684 | 28866 | + | NC_016639.1 | Rickettsia slovaca 13-B |
2 | 25436 | 25618 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
3 | 28186 | 28368 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03797.21 | 1.0 | 3 | 2399 | same-strand | Autotransporter beta-domain |
2 | PF13401.8 | 1.0 | 3 | 343 | same-strand | AAA domain |
3 | PF05729.14 | 1.0 | 3 | 343 | same-strand | NACHT domain |
4 | PF00430.20 | 1.0 | 3 | 700.0 | opposite-strand | ATP synthase B/B' CF(0) |
5 | PF05405.16 | 1.0 | 3 | 700.0 | opposite-strand | Mitochondrial ATP synthase B chain precursor (ATP-synt B) |
6 | PF02326.17 | 1.0 | 3 | 1067 | opposite-strand | Plant ATP synthase F0 |
7 | PF00137.23 | 1.0 | 3 | 1559 | opposite-strand | ATP synthase subunit C |
8 | PF00119.22 | 1.0 | 3 | 1979 | opposite-strand | ATP synthase A chain |