Result : Q92JP4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0023 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 25983 |
| Right | 26186 |
| Strand | + |
| Nucleotide Sequence | ATGTTATGTTTTGAAGCGATTTGCTTAGGAGCGATTAACAGCTCTAGCAAAAACTTCACTTGTGTAAAAGAATTTGTTAGAGCCTATCCTGAATTAACAAATAAGATAACAAACGAACATCCTGAATATTTTATTGATGGCTCAATATTACGGATATGTGTTAATGATAAAGCAATTTTAAATAAATTGCTAGCTAGTGGTTAG |
| Sequence | MLCFEAICLGAINSSSKNFTCVKEFVRAYPELTNKITNEHPEYFIDGSILRICVNDKAILNKLLASG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JP4 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 25983 | 26186 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 29230 | 29433 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 33165 | 33377 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 4 | 703999 | 704181 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 5 | 47195 | 47398 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00430.20 | 0.8 | 4 | 238.0 | opposite-strand | ATP synthase B/B' CF(0) |
| 2 | PF05405.16 | 0.8 | 4 | 238.0 | opposite-strand | Mitochondrial ATP synthase B chain precursor (ATP-synt B) |
| 3 | PF02326.17 | 0.8 | 4 | 500.0 | opposite-strand | Plant ATP synthase F0 |
| 4 | PF00137.23 | 0.8 | 4 | 992.0 | opposite-strand | ATP synthase subunit C |
| 5 | PF00119.22 | 0.8 | 4 | 1410.0 | opposite-strand | ATP synthase A chain |
| 6 | PF09527.12 | 0.8 | 4 | 2139.0 | opposite-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
++ More..