Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP000885.1 |
Organism | Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) (Clostridium phytofermentans) |
Left | 829957 |
Right | 830244 |
Strand | + |
Nucleotide Sequence | ATGGATATCACTGATCAAACCATAGAATATGTTTCAACATTAGCAAAGCTTAGTTTACAACCAGAAGAAAAAGAAAAGGCGAAGAAAGATCTTGGTAATATTTTAGGATACATTGATAAAATGAAGGAATTAAATACAGATGGAATAGAACCAATGTCACATGTACTTCCTATGAAGAATGTATTTCGTGAAGATGTGGTTACGAATGAAGAGAACCGCGAAGAACTTCTTAAGAATGCACCAAAACAAATGGATGGTTGTTTTATGGTTCCAAAGACCGTAGATTAG |
Sequence | MDITDQTIEYVSTLAKLSLQPEEKEKAKKDLGNILGYIDKMKELNTDGIEPMSHVLPMKNVFREDVVTNEENREELLKNAPKQMDGCFMVPKTVD |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | A9KJ25 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 829957 | 830244 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
2 | 2552901 | 2553188 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
3 | 1385287 | 1385574 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
4 | 2552901 | 2553194 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
5 | 1080145 | 1080393 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
6 | 4763584 | 4763877 | - | NZ_CP022464.2 | Enterocloster bolteae |
7 | 2192081 | 2192365 | - | NZ_LR699011.1 | Roseburia hominis |
8 | 3616938 | 3617207 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
9 | 1261247 | 1261540 | - | NZ_CP070062.1 | Coprococcus comes |
10 | 456422 | 456718 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
11 | 1688399 | 1688692 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
12 | 140069 | 140326 | + | NZ_CP039126.1 | Blautia producta |
13 | 850185 | 850418 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
14 | 1963934 | 1964167 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
15 | 1024580 | 1024864 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
16 | 716158 | 716445 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
17 | 2670026 | 2670298 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01425.23 | 1.0 | 17 | 25 | same-strand | Amidase |
2 | PF02934.17 | 1.0 | 17 | 1515 | same-strand | GatB/GatE catalytic domain |
3 | PF02637.20 | 1.0 | 17 | 1515 | same-strand | GatB domain |