Result : Q92JL0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0057 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 49114 |
| Right | 49389 |
| Strand | - |
| Nucleotide Sequence | TTGCTAGGAAAAAATGATATTAAAAATGTTCATAAAAAATTAAATGTTGCTAAAGATTTTCAAAATTTCAATGATGAGCATTGTAATATAGTCACTTTGTCAAAAGTCATCAATGATGAGGGAAAAAAGCATATTGTAGTCGAAGCGGAAGTAGCTTTTAAAGGCTTGACAGAAGAACAAAAGCAAGAATATCAAAATAGAGACGGTAAAAACTGGTATAATGTAATGCCTGAATGCGAGAGGAAGCTTGTTGATCAGTATACTGATACAATTTAA |
| Sequence | MLGKNDIKNVHKKLNVAKDFQNFNDEHCNIVTLSKVINDEGKKHIVVEAEVAFKGLTEEQKQEYQNRDGKNWYNVMPECERKLVDQYTDTI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JL0 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 49114 | 49389 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 52234 | 52509 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 53394 | 53615 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07724.16 | 0.67 | 2 | 553.0 | opposite-strand | AAA domain (Cdc48 subfamily) |
| 2 | PF17871.3 | 1.0 | 3 | 508 | opposite-strand | AAA lid domain |
| 3 | PF10431.11 | 1.0 | 3 | 604 | opposite-strand | C-terminal, D2-small domain, of ClpB protein |
| 4 | PF00004.31 | 1.0 | 3 | 508 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 5 | PF02861.22 | 1.0 | 3 | 508 | opposite-strand | Clp amino terminal domain, pathogenicity island component |
| 6 | PF07728.16 | 0.67 | 2 | 553.0 | opposite-strand | AAA domain (dynein-related subfamily) |
| 7 | PF17462.4 | 1.0 | 3 | 3324 | same-strand | Family of unknown function (DUF5424) |
| 8 | PF00814.27 | 1.0 | 3 | 3942 | same-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 9 | PF00487.26 | 0.67 | 2 | 5167.0 | same-strand | Fatty acid desaturase |
++ More..