Result : Q92JJ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0070 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 63304 |
| Right | 63459 |
| Strand | + |
| Nucleotide Sequence | ATGATACTGCTTATGTGTCTTACATCTTACAGGAAAAACCGAAGAGCGTATAAAAAAGAATTTGAAGCCATGCTGAAATGTGAAGAAGGGGACTTAAGTTGTCCATTTATAATCAAGACTCAGAACCTAGGTTTTTTTGTGGACATTTCTAGTTGA |
| Sequence | MILLMCLTSYRKNRRAYKKEFEAMLKCEEGDLSCPFIIKTQNLGFFVDISS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JJ7 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 66916 | 67071 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 2 | 63304 | 63459 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 3 | 66152 | 66304 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 91103 | 91240 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016639.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01171.22 | 0.75 | 3 | 3869 | same-strand | PP-loop family |
| 2 | PF01434.20 | 1.0 | 4 | 1918.0 | same-strand | Peptidase family M41 |
| 3 | PF00004.31 | 1.0 | 4 | 1918.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF06480.17 | 1.0 | 4 | 1918.0 | same-strand | FtsH Extracellular |
| 5 | PF17862.3 | 1.0 | 4 | 1918.0 | same-strand | AAA+ lid domain |
| 6 | PF13085.8 | 1.0 | 4 | 288.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 7 | PF13534.8 | 1.0 | 4 | 288.5 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 1.0 | 4 | 288.5 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF13183.8 | 1.0 | 4 | 288.5 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF02636.19 | 1.0 | 4 | 132.5 | opposite-strand | Putative S-adenosyl-L-methionine-dependent methyltransferase |
| 11 | PF01790.20 | 1.0 | 4 | 1331.5 | opposite-strand | Prolipoprotein diacylglyceryl transferase |
| 12 | PF00924.20 | 1.0 | 4 | 2354.0 | same-strand | Mechanosensitive ion channel |
| 13 | PF14849.8 | 1.0 | 4 | 3709.0 | same-strand | YidC periplasmic domain |
| 14 | PF02096.22 | 1.0 | 4 | 3709.0 | same-strand | 60Kd inner membrane protein |
| 15 | PF01066.23 | 1.0 | 4 | 5395.0 | same-strand | CDP-alcohol phosphatidyltransferase |
++ More..