Result : Q92JF9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RC0108 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 103353 |
| Right | 103538 |
| Strand | + |
| Nucleotide Sequence | TTGGCAATGAGGCTTGTTACTGCAGAAGAGATACCCAAATTACACAAGTTAGTACAAGATAATAAAATGATATTAGCATGCCAAACCAAAGAAAAAACACTAAAGATTTTAAGTGATTATTTACAGAAAGAATTTGGGATGCATGCTAATGAAACTACAATAGCATCTTATGATGGGTACATATAA |
| Sequence | MAMRLVTAEEIPKLHKLVQDNKMILACQTKEKTLKILSDYLQKEFGMHANETTIASYDGYI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92JF9 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 103353 | 103538 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 107084 | 107296 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 105683 | 105883 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 407523 | 407729 | - | NZ_LN794217.1 | Rickettsia monacensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02233.18 | 1.0 | 4 | 3438.0 | opposite-strand | NAD(P) transhydrogenase beta subunit |
| 2 | PF03922.16 | 1.0 | 4 | 2563.0 | opposite-strand | OmpW family |
| 3 | PF00892.22 | 1.0 | 4 | 1524.0 | same-strand | EamA-like transporter family |
| 4 | PF03840.16 | 1.0 | 4 | 348.0 | same-strand | Preprotein translocase SecG subunit |
| 5 | PF03797.21 | 1.0 | 4 | 1567.0 | opposite-strand | Autotransporter beta-domain |
| 6 | PF01406.21 | 1.0 | 4 | 7305.0 | same-strand | tRNA synthetases class I (C) catalytic domain |
| 7 | PF09190.13 | 0.75 | 3 | 7192 | same-strand | DALR domain |
| 8 | PF00318.22 | 1.0 | 4 | 8928.0 | same-strand | Ribosomal protein S2 |
++ More..