Result : Q92JF8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein-export membrane protein SecG |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 103905 |
| Right | 104207 |
| Strand | + |
| Nucleotide Sequence | ATGATAGACATTCTTCTTTTTGTACATATTACTATTGCAATATTGCTAATTATAGTTATTCTGATGCAGCGTAGCGGATCGGATGGAATTAGTAGTATAAGCGGCGGTAATAATATGGGAGTAGTCAGTGCTAAAACAGTCGGTAATTTTCTTACTAAAAGCACTATAATACTTACAACATTATTTTTAATAAATGCAATAGTACTTGCTAACCTTTCCTCAAAAAAGAAATCTGATTTAGTTTCTAAGATTAATGAAATTGAAGAAAATCAAGCAGAAAATAGTTTACCTATAGCTAAATAG |
| Sequence | MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTTLFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK |
| Source of smORF | Swiss-Prot |
| Function | Involved in protein export. Participates in an early event of protein translocation (By similarity). {ECO:0000250}. |
| Pubmed ID | 11557893 |
| Domain | CDD:415590 |
| Functional Category | Others |
| Uniprot ID | Q92JF8 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 106237 | 106539 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 2 | 103905 | 104207 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 3 | 107637 | 107939 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 4 | 108911 | 109213 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 5 | 135396 | 135698 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 6 | 406879 | 407181 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 7 | 139890 | 140192 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 8 | 99977 | 100279 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 9 | 88176 | 88478 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 10 | 73210 | 73512 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 11 | 88067 | 88369 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 12 | 1441650 | 1441952 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010263.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03922.16 | 0.92 | 11 | 2961 | opposite-strand | OmpW family |
| 2 | PF00892.22 | 0.92 | 11 | 1919 | same-strand | EamA-like transporter family |
| 3 | PF03797.21 | 0.92 | 11 | 988 | opposite-strand | Autotransporter beta-domain |
| 4 | PF01406.21 | 0.83 | 10 | 6782.5 | same-strand | tRNA synthetases class I (C) catalytic domain |
| 5 | PF09190.13 | 0.67 | 8 | 6765.0 | same-strand | DALR domain |
| 6 | PF00318.22 | 0.67 | 8 | 8436.0 | same-strand | Ribosomal protein S2 |
++ More..