Result : Q92JF2

Protein Information

• Protein name: Uncharacterized protein RC0115
• NCBI Accession ID: AE006914.1
• Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)
• Left: 115165
• Right: 115353
• Strand: +
• Nucleotide Sequence: ATGACAACTAATCGTGTAGATCCTTTAGAGCAAACTTCCCCTAATACTCCTACCTCTAAAAGAGAAAAGGCTAAAATATACGGAAAAAAACTGGTAGATAGTGCAAAGATTGGAGCTAAAACCCTTTCAAATGCTTATAAAGTGACAATCGGTACAATAGAAGTCGTCGGTCCGGGAAGTGATTTTTAA
• Sequence: MTTNRVDPLEQTSPNTPTSKREKAKIYGKKLVDSAKIGAKTLSNAYKVTIGTIEVVGPGSDF
• Source of smORF: Swiss-Prot
• Pubmed ID: 11557893
• Functional Category: Others
• Uniprot ID: Q92JF2
• ORF Length (Amino Acid): 62

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	115165	115353	+	NC_003103.1	Rickettsia conorii str. Malish 7
2	118683	118874	+	NC_016639.1	Rickettsia slovaca 13-B

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003103.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03797.21	1.0	2	4661.5	opposite-strand	Autotransporter beta-domain
2	PF01406.21	1.0	2	3048.5	same-strand	tRNA synthetases class I (C) catalytic domain
3	PF09190.13	1.0	2	3048.5	same-strand	DALR domain
4	PF00318.22	1.0	2	1914.5	same-strand	Ribosomal protein S2
5	PF00889.21	1.0	2	790.0	same-strand	Elongation factor TS
6	PF04413.18	1.0	2	542.5	opposite-strand	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase)
7	PF04028.15	1.0	2	1933.5	opposite-strand	Domain of unknown function (DUF374)
8	PF00155.23	1.0	2	2740.5	opposite-strand	Aminotransferase class I and II