Result : Q92JD5

Protein Information

• Protein name: Uncharacterized protein RC0132
• NCBI Accession ID: AE006914.1
• Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)
• Left: 126803
• Right: 127030
• Strand: -
• Nucleotide Sequence: TTGATAGAACAAGATTTAATAAAAGTACGAATAATTGGAGGTAATGATTCGCCTGAATCATCTAAATACTTGGAAGATATTCGTACTACTTTAAATGGTATTGATAATAATACTAATATGATTAATATAATAGGTTTAGATGCATGTAAAAATATACATCCCAATTCTTTTGAATTAGATGGCTATCACGGGGGAGTTAGAGCTTTAGATTGTAGAATATTAAATTGA
• Sequence: MIEQDLIKVRIIGGNDSPESSKYLEDIRTTLNGIDNNTNMINIIGLDACKNIHPNSFELDGYHGGVRALDCRILN
• Source of smORF: Swiss-Prot
• Pubmed ID: 11557893
• Functional Category: Others
• Uniprot ID: Q92JD5
• ORF Length (Amino Acid): 75

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	126803	127030	-	NC_003103.1	Rickettsia conorii str. Malish 7
2	130106	130318	-	NC_016639.1	Rickettsia slovaca 13-B

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003103.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01168.22	1.0	2	2162.5	opposite-strand	Alanine racemase, N-terminal domain
2	PF00842.23	1.0	2	2162.5	opposite-strand	Alanine racemase, C-terminal domain
3	PF02405.18	1.0	2	1226.5	opposite-strand	Permease MlaE
4	PF00005.29	1.0	2	318.5	opposite-strand	ABC transporter
5	PF17629.4	1.0	2	68.5	opposite-strand	Family of unknown function (DUF5510)