Result : A9KH12

Protein Information

• Protein name: Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase)
• Organism: Coxiella burnetii (strain Dugway 5J108-111)
• Sequence: MTQKEKNETCIHATVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEWLWEGPPQAAVSNVNWEEIVVEDYSDFRVR
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional
• Pubmed ID: 19047403
• Domain: CDD:412440
• Functional Category: Others
• Uniprot ID: A9KH12
• ORF Length (Amino Acid): 95

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1902256	1902543	+	NC_002971.4	Coxiella burnetii RSA 493
2	487683	487919	+	NZ_AP014879.1	Sulfuricaulis limicola
3	1757034	1757267	-	NZ_CP011412.1	Sedimenticola thiotaurini

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_AP014879.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03960.17	0.67	2	3429.0	opposite-strand	ArsC family
2	PF03631.17	0.67	2	2214.0	same-strand	Virulence factor BrkB
3	PF00578.23	0.67	2	86.5	same-strand	AhpC/TSA family
4	PF08534.12	0.67	2	86.5	same-strand	Redoxin
5	PF00587.27	0.67	2	3033.0	opposite-strand	tRNA synthetase class II core domain (G, H, P, S and T)
6	PF04073.17	0.67	2	3033.0	opposite-strand	Aminoacyl-tRNA editing domain
7	PF03129.22	0.67	2	3033.0	opposite-strand	Anticodon binding domain