Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0335 protein RC0153 |
NCBI Accession ID | AE006914.1 |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | 153552 |
Right | 153788 |
Strand | - |
Nucleotide Sequence | ATGTCAGAAGTAGTAGTAAAAGAACAATTAGAGCAATATATAAGCAAAATAGAAAGATTAGAACAAGAAAAAGCTGATTTATCTCAAGAAGTAAAAGATATCTTCCAAGATGCTTCTTCACATGGATTTGATGTTAAAGCTATGAAATCTATATTGAAACTAAAGAAATTAGATAAAGATAAACTTGCCGAGCAGGACGCTATGCTTGAGCTTTATAGAGATACTTTAGGGATTTGA |
Sequence | MSEVVVKEQLEQYISKIERLEQEKADLSQEVKDIFQDASSHGFDVKAMKSILKLKKLDKDKLAEQDAMLELYRDTLGI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23845. Profile Description: Uncharacterized protein conserved in bacteria (DUF2312). hypothetical protein; Provisional |
Pubmed ID | 11557893 |
Domain | CDD:420047 |
Functional Category | Others |
Uniprot ID | Q92JB4 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 153552 | 153788 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
2 | 157265 | 157501 | - | NC_016639.1 | Rickettsia slovaca 13-B |
3 | 158890 | 159126 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
4 | 88065 | 88301 | + | NZ_AP019563.1 | Rickettsia asiatica |
5 | 472099 | 472335 | - | NZ_LN794217.1 | Rickettsia monacensis |
6 | 156072 | 156308 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
7 | 159658 | 159894 | - | NC_009881.1 | Rickettsia akari str. Hartford |
8 | 365 | 601 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
9 | 1277161 | 1277397 | + | NC_007940.1 | Rickettsia bellii RML369-C |
10 | 135337 | 135573 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
11 | 133863 | 134099 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
12 | 25145 | 25381 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01746.23 | 0.83 | 10 | 604.5 | opposite-strand | tRNA (Guanine-1)-methyltransferase |
2 | PF01245.22 | 0.83 | 10 | 170.5 | opposite-strand | Ribosomal protein L19 |
3 | PF02355.18 | 0.92 | 11 | 73 | opposite-strand | Protein export membrane protein |
4 | PF07549.16 | 0.92 | 11 | 73 | opposite-strand | SecD/SecF GG Motif |
5 | PF01512.19 | 0.92 | 11 | 1164 | opposite-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
6 | PF10589.11 | 0.92 | 11 | 1164 | opposite-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
7 | PF10531.11 | 0.92 | 11 | 1164 | opposite-strand | SLBB domain |
8 | PF10502.11 | 0.92 | 11 | 2611 | opposite-strand | Signal peptidase, peptidase S26 |
9 | PF14622.8 | 0.92 | 11 | 3413 | opposite-strand | Ribonuclease-III-like |
10 | PF00636.28 | 0.92 | 11 | 3413 | opposite-strand | Ribonuclease III domain |
11 | PF00035.28 | 0.92 | 11 | 3413 | opposite-strand | Double-stranded RNA binding motif |
12 | PF01926.25 | 0.83 | 10 | 4083.5 | opposite-strand | 50S ribosome-binding GTPase |
13 | PF07650.19 | 0.83 | 10 | 4083.5 | opposite-strand | KH domain |
14 | PF02421.20 | 0.67 | 8 | 4083.5 | opposite-strand | Ferrous iron transport protein B |