| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0369 protein RC0209 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 216994 |
| Right | 217275 |
| Strand | - |
| Nucleotide Sequence | ATGGACGATAAAAAAGATAATAGACATCTTTCCAAACCAGCTTATAGAGAGGAATGTACAGGAGACACGGAACGCAGCACTACAGCGTATATGGACATACTTGAGGATGTGAGTACCGGATCGACGTCTAAATTACCTCTAGAAGCGAAGTTTGTAAAGATATCTAATAATATATCAGAAAAAGAAAATTTACCAAAAGAAAAAGAAATTGGCGGTGTTAAAGGTCTAGAACCGACAAGATACGGGGACTGGCAGCATAAAGGTAAAGTTACAGATTTCTAA |
| Sequence | MDDKKDNRHLSKPAYREECTGDTERSTTAYMDILEDVSTGSTSKLPLEAKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of COG5508. Profile Description: Uncharacterized protein [Function unknown]. **The ORF matches to the profile of TIGR01045. Profile Description: Rickettsial palindromic element RPE1 domain. This model describes protein translations of the first family described, RPE1, of Rickettsia palindromic elements (RPE). In Rickettsia conorii, 19 copies are found within protein coding regions, where they encode an insert relative to homologs from other species but do not disrupt the reading frame. Insertion is always in the same reading frame. This model finds RPE-encoded regions in several Rickettsial species and, so far, no where else. |
| Pubmed ID | 11557893 |
| Domain | CDD:227795,CDD:273412 |
| Functional Category | Others |
| Uniprot ID | Q92J60 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 216994 | 217275 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 221560 | 221841 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 220549 | 220833 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 222788 | 223069 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01029.20 | 1.0 | 4 | 3550.0 | opposite-strand | NusB family |
| 2 | PF01728.21 | 1.0 | 4 | 2732.0 | opposite-strand | FtsJ-like methyltransferase |
| 3 | PF13847.8 | 1.0 | 4 | 2732.0 | opposite-strand | Methyltransferase domain |
| 4 | PF03364.22 | 1.0 | 4 | 0.0 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 5 | PF04452.16 | 1.0 | 4 | 13.0 | opposite-strand | RNA methyltransferase |
| 6 | PF00873.21 | 1.0 | 4 | 1327.0 | same-strand | AcrB/AcrD/AcrF family |
| 7 | PF00216.23 | 1.0 | 4 | 4829.0 | opposite-strand | Bacterial DNA-binding protein |
| 8 | PF04070.14 | 0.75 | 3 | 836 | same-strand | Domain of unknown function (DUF378) |