Result : Q92J57
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-binding protein HU |
| NCBI Accession ID | |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNKTEFIAFMTDHGHNHKHASHKTLTKAEAEKALNLVLDSVISAIKSHHNINITGFGSFEIHHRKAREGRNPKTGAKMKIDAYNQPTFRAGRKMKEACN |
| Source of smORF | Swiss-Prot |
| Function | Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. {ECO:0000250}. |
| Pubmed ID | 11557893 |
| Domain | CDD:412265 |
| Functional Category | DNA-binding |
| Uniprot ID | Q92J57 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 225695 | 225994 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 2 | 222137 | 222436 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 3 | 226703 | 227002 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 4 | 227906 | 228205 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 5 | 555331 | 555630 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 6 | 1227180 | 1227479 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 7 | 256016 | 256315 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 8 | 229030 | 229329 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 9 | 224528 | 224827 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 10 | 200354 | 200653 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 11 | 202951 | 203250 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 12 | 1238023 | 1238328 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010263.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04452.16 | 0.67 | 8 | 4040.5 | same-strand | RNA methyltransferase |
| 2 | PF04070.14 | 0.67 | 8 | 3649.0 | opposite-strand | Domain of unknown function (DUF378) |
| 3 | PF00873.21 | 0.75 | 9 | 509 | opposite-strand | AcrB/AcrD/AcrF family |
| 4 | PF00448.24 | 1.0 | 12 | 1192.5 | same-strand | SRP54-type protein, GTPase domain |
| 5 | PF02978.21 | 1.0 | 12 | 1192.5 | same-strand | Signal peptide binding domain |
| 6 | PF02881.21 | 1.0 | 12 | 1192.5 | same-strand | SRP54-type protein, helical bundle domain |
++ More..