Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-binding protein HU |
NCBI Accession ID | |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MNKTEFIAFMTDHGHNHKHASHKTLTKAEAEKALNLVLDSVISAIKSHHNINITGFGSFEIHHRKAREGRNPKTGAKMKIDAYNQPTFRAGRKMKEACN |
Source of smORF | Swiss-Prot |
Function | Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. {ECO:0000250}. |
Pubmed ID | 11557893 |
Domain | CDD:412265 |
Functional Category | DNA-binding |
Uniprot ID | Q92J57 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 225695 | 225994 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
2 | 222137 | 222436 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
3 | 226703 | 227002 | + | NC_016639.1 | Rickettsia slovaca 13-B |
4 | 227906 | 228205 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
5 | 555331 | 555630 | + | NZ_LN794217.1 | Rickettsia monacensis |
6 | 1227180 | 1227479 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
7 | 256016 | 256315 | + | NZ_AP019563.1 | Rickettsia asiatica |
8 | 229030 | 229329 | + | NC_009881.1 | Rickettsia akari str. Hartford |
9 | 224528 | 224827 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
10 | 200354 | 200653 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
11 | 202951 | 203250 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
12 | 1238023 | 1238328 | - | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04452.16 | 0.67 | 8 | 4040.5 | same-strand | RNA methyltransferase |
2 | PF04070.14 | 0.67 | 8 | 3649.0 | opposite-strand | Domain of unknown function (DUF378) |
3 | PF00873.21 | 0.75 | 9 | 509 | opposite-strand | AcrB/AcrD/AcrF family |
4 | PF00448.24 | 1.0 | 12 | 1192.5 | same-strand | SRP54-type protein, GTPase domain |
5 | PF02978.21 | 1.0 | 12 | 1192.5 | same-strand | Signal peptide binding domain |
6 | PF02881.21 | 1.0 | 12 | 1192.5 | same-strand | SRP54-type protein, helical bundle domain |