Result : Q92IM4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein RC0396 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 396624 |
| Right | 396908 |
| Strand | + |
| Nucleotide Sequence | ATGATAAAAAATTATCGGAAAAAGTTTTGGAAGAATAGTACTACCAAATCACAAAATTTTATTGAACTAAACGACATTGCATATGGTAATTTAATCAGAGTCGACATAGAAGCTTATCGAGAAAATGTTATAGTATATAGATGTATTAATTTAATTGCACAATCGGCGGGACATGTTCCGTGGAAAGTGCTTAAAAGTAAAACCGGAGAAGTAATATTTAGACTATCCGGTGCATTATTTACTAACAAAACCGAATCCCAAAAAAGCCGGAGCGGATTTTGTTAG |
| Sequence | MIKNYRKKFWKNSTTKSQNFIELNDIAYGNLIRVDIEAYRENVIVYRCINLIAQSAGHVPWKVLKSKTGEVIFRLSGALFTNKTESQKSRSGFC |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92IM4 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 396624 | 396908 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 400158 | 400442 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 3 | 401653 | 401937 | + | NC_016639.1 | Rickettsia slovaca 13-B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02534.16 | 1.0 | 3 | 3425 | same-strand | Type IV secretory system Conjugative DNA transfer |
| 2 | PF12696.9 | 1.0 | 3 | 3425 | same-strand | TraM recognition site of TraD and TraG |
| 3 | PF02541.18 | 1.0 | 3 | 2011 | same-strand | Ppx/GppA phosphatase family |
| 4 | PF11019.10 | 1.0 | 3 | 1063.5 | same-strand | Protein of unknown function (DUF2608) |
| 5 | PF00459.27 | 1.0 | 3 | 2329 | same-strand | Inositol monophosphatase family |
++ More..