Result : Q92IM3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein RC0397 |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 396853 |
| Right | 397071 |
| Strand | + |
| Nucleotide Sequence | GTGCATTATTTACTAACAAAACCGAATCCCAAAAAAGCCGGAGCGGATTTTGTTAGTGAGCTAATTGCAAGCAAATTATTATTCGGTAATAGTTATATTTTATCAGCTCTAGACTCGTACCCTAAAGAGATTTACTTACTACCGGCTCTTGTTACGGAACTGGTTATAGAACATAACAATTTAGTTTCTTATTTTGATTTGAAATTATTTGTCCGTTAA |
| Sequence | MHYLLTKPNPKKAGADFVSELIASKLLFGNSYILSALDSYPKEIYLLPALVTELVIEHNNLVSYFDLKLFVR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11557893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q92IM3 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 396853 | 397071 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 401882 | 402100 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 402361 | 402582 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 400387 | 400605 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02541.18 | 1.0 | 4 | 2237.5 | same-strand | Ppx/GppA phosphatase family |
| 2 | PF11019.10 | 1.0 | 4 | 900.5 | same-strand | Protein of unknown function (DUF2608) |
| 3 | PF00459.27 | 1.0 | 4 | 2166.0 | same-strand | Inositol monophosphatase family |
| 4 | PF00488.23 | 1.0 | 4 | 3082.0 | opposite-strand | MutS domain V |
| 5 | PF01624.22 | 1.0 | 4 | 3082.0 | opposite-strand | MutS domain I |
| 6 | PF05192.20 | 1.0 | 4 | 3082.0 | opposite-strand | MutS domain III |
| 7 | PF05188.19 | 1.0 | 4 | 3082.0 | opposite-strand | MutS domain II |
| 8 | PF05190.20 | 1.0 | 4 | 3082.0 | opposite-strand | MutS family domain IV |
++ More..