Protein Information |
Information Type | Description |
---|---|
Protein name | Putative ankyrin repeat protein RC0502 |
NCBI Accession ID | AE006914.1 |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | 495771 |
Right | 495983 |
Strand | - |
Nucleotide Sequence | TTGGATGTTAATACTAAAGATGGAAAGGGACGTATACCTATACATTATGCAACTTATTCTAAACAGCACGAAATAACTCAAATTTTAATTTTATTACAACCCGGCAGTGAAATTGATACAGTAGACAATTATGGCGGCACACCTTTTTTCTATTTGCTACTAAAGCATGAATCAGGTCAAAATAAAACGTTACTGGACTTCTTTTTACGTTAA |
Sequence | MDVNTKDGKGRIPIHYATYSKQHEITQILILLQPGSEIDTVDNYGGTPFFYLLLKHESGQNKTLLDFFLR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam13857. Profile Description: Ankyrin repeats (many copies). |
Pubmed ID | 11557893 |
Domain | CDD:404699 |
Functional Category | Others |
Uniprot ID | Q92IB8 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 495771 | 495983 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
2 | 501348 | 501554 | - | NC_016639.1 | Rickettsia slovaca 13-B |
3 | 685492 | 685731 | + | NZ_AP019563.1 | Rickettsia asiatica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04392.14 | 0.67 | 2 | 2291.0 | opposite-strand | ABC transporter substrate binding protein |
2 | PF02653.18 | 0.67 | 2 | 1447.0 | opposite-strand | Branched-chain amino acid transport system / permease component |
3 | PF00005.29 | 0.67 | 2 | 728.0 | opposite-strand | ABC transporter |
4 | PF02600.18 | 1.0 | 3 | 876 | same-strand | Disulfide bond formation protein DsbB |
5 | PF01921.20 | 1.0 | 3 | 1574 | opposite-strand | tRNA synthetases class I (K) |