| Protein name |
Putative ankyrin repeat protein RC0701 |
| NCBI Accession ID |
AE006914.1 |
| Organism |
Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left |
674504 |
| Right |
674668 |
| Strand |
+ |
| Nucleotide Sequence |
ATGCATAAAAATACGCATACAAAACCTGATGTAAATTTCTATGATAAGAGTGGTAAAACACCACTTGATTGGTATAGCGATTATAACGCTACTAAAATCGTAGAAACTTTAATAAAAAATGGCGGTAATGTATCTTCAGTGTACTCAAGATGCAGCTACTCCTAG |
| Sequence |
MHKNTHTKPDVNFYDKSGKTPLDWYSDYNATKIVETLIKNGGNVSSVYSRCSYS |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl02529. Profile Description: Ankyrin repeat. Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. |
| Pubmed ID |
11557893
|
| Domain |
CDD:413359 |
| Functional Category |
Others |
| Uniprot ID |
Q92HS0
|
| ORF Length (Amino Acid) |
54 |