Result : Q92HL4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-binding protein HU-like |
| NCBI Accession ID | AE006914.1 |
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Left | 720651 |
| Right | 720893 |
| Strand | - |
| Nucleotide Sequence | ATGATTACTAAGAATTATTTAATAGATAAAATACATGATAAGCTGAATTGTCTTTCTAAAGAAGATGTTAAAGATTCAGTAGATTTAATTTTAGATTATTTAAACGAATCTCTTAAAAAACAAAAGCGTATCGAAATCAGAAATTTCGGTAATTTCTCTATCCGCAAACGCAAATTTCCTGAAAGCGAAAAATTCTATAATACGGTTTATTACAGAATGCCTAAAAATTTATTTAAGGAATAA |
| Sequence | MITKNYLIDKIHDKLNCLSKEDVKDSVDLILDYLNESLKKQKRIEIRNFGNFSIRKRKFPESEKFYNTVYYRMPKNLFKE |
| Source of smORF | Swiss-Prot |
| Function | Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. {ECO:0000250}. |
| Pubmed ID | 11557893 |
| Domain | CDD:412265 |
| Functional Category | DNA-binding |
| Uniprot ID | Q92HL4 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 720651 | 720893 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 2 | 688794 | 689036 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 686588 | 686830 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 689779 | 690021 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 5 | 651285 | 651527 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 6 | 645447 | 645689 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 7 | 758912 | 759160 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 8 | 682576 | 682824 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 9 | 815438 | 815662 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01343.20 | 0.89 | 8 | 3.0 | same-strand | Peptidase family S49 |
| 2 | PF07497.14 | 1.0 | 9 | 1045 | same-strand | Rho termination factor, RNA-binding domain |
| 3 | PF00006.27 | 1.0 | 9 | 1045 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 4 | PF07498.14 | 1.0 | 9 | 1045 | same-strand | Rho termination factor, N-terminal domain |
| 5 | PF08242.14 | 0.89 | 8 | 2799.0 | same-strand | Methyltransferase domain |
| 6 | PF13649.8 | 0.89 | 8 | 2799.0 | same-strand | Methyltransferase domain |
| 7 | PF08241.14 | 0.89 | 8 | 2799.0 | same-strand | Methyltransferase domain |
| 8 | PF02272.21 | 0.89 | 8 | 4165.0 | same-strand | DHHA1 domain |
| 9 | PF17768.3 | 0.89 | 8 | 4165.0 | same-strand | RecJ OB domain |
| 10 | PF01368.22 | 0.89 | 8 | 4165.0 | same-strand | DHH family |
| 11 | PF03462.20 | 0.78 | 7 | 6080 | same-strand | PCRF domain |
| 12 | PF00472.22 | 0.78 | 7 | 6080 | same-strand | RF-1 domain |
++ More..