Result : A9KGR6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000733.1 |
| Organism | Coxiella burnetii (strain Dugway 5J108-111) |
| Left | 1776160 |
| Right | 1776453 |
| Strand | - |
| Nucleotide Sequence | ATGGCACGCGTAACAGTTGAAGATTGTCTCGAACATGTCGAAAATCGCTTTGATTTAGTGCTGAAAGCAGCAAAGCGAGCTCATATTCTGGAATTAGGTGGGGCAGAACCGATGGTTCCCAGAGATAATGATAAACCCGCCGTCCTTGCGCTTCGTGAAATAGCAGCCGGCTACGACGTCACTCGAGAAGGGCAAGAGCAGGAAACGGAAGAAGTTGACGTTGGCCGTAATGTTCTCGCTGAAACAGCAAAAATGAATAAAGCGGTAGCTTCCCAGAAAGAGAGTGAAGTATAA |
| Sequence | MARVTVEDCLEHVENRFDLVLKAAKRAHILELGGAEPMVPRDNDKPAVLALREIAAGYDVTREGQEQETEEVDVGRNVLAETAKMNKAVASQKESEV |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19047403 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A9KGR6 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 268204 | 268497 | + | NC_002971.4 | Coxiella burnetii RSA 493 |
| 2 | 440440 | 440709 | - | NZ_CP011381.2 | Moraxella bovoculi |
| 3 | 1664406 | 1664675 | + | NZ_CP011158.1 | Moraxella ovis |
| 4 | 3091591 | 3091872 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 5 | 106642 | 106935 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002971.4
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.6 | 3 | 78 | same-strand | Guanylate kinase |
| 2 | PF13328.8 | 1.0 | 5 | 202 | same-strand | HD domain |
| 3 | PF02824.23 | 1.0 | 5 | 202 | same-strand | TGS domain |
| 4 | PF01966.24 | 1.0 | 5 | 202 | same-strand | HD domain |
| 5 | PF01042.23 | 1.0 | 5 | 2381 | same-strand | Endoribonuclease L-PSP |
| 6 | PF00270.31 | 0.8 | 4 | 3005.5 | same-strand | DEAD/DEAH box helicase |
| 7 | PF04851.17 | 0.8 | 4 | 3005.5 | same-strand | Type III restriction enzyme, res subunit |
++ More..