Result : Q92HD4

Protein Information

• Protein name: Putative uncharacterized protein RC0837
• NCBI Accession ID: AE006914.1
• Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)
• Left: 792171
• Right: 792332
• Strand: -
• Nucleotide Sequence: ATGTTATTAGCTTGTGGTCTTGGTGTGGCACTTGGAGGTGGATATGAGCTGTTATTGCACTCAAGCTTTATTATAGGAAATCAAGAACTTAACGCAGGGCTTGTAGAACTTGGTGTGGGTTTAATATCCGGGTGGGGCGGTGTTACCGAAATGTTTGCTTGA
• Sequence: MLLACGLGVALGGGYELLLHSSFIIGNQELNAGLVELGVGLISGWGGVTEMFA
• Source of smORF: Swiss-Prot
• Pubmed ID: 11557893
• Functional Category: Others
• Uniprot ID: Q92HD4
• ORF Length (Amino Acid): 53

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	792171	792332	-	NC_003103.1	Rickettsia conorii str. Malish 7
2	799777	799938	-	NC_016639.1	Rickettsia slovaca 13-B

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003103.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17973.3	1.0	2	597.0	opposite-strand	Bacterial Alpha-2-macroglobulin MG10 domain
2	PF01835.21	1.0	2	597.0	opposite-strand	MG2 domain
3	PF11974.10	1.0	2	597.0	opposite-strand	Bacterial alpha-2-macroglobulin MG3 domain
4	PF00207.24	1.0	2	597.0	opposite-strand	Alpha-2-macroglobulin family
5	PF17972.3	1.0	2	597.0	opposite-strand	Bacterial Alpha-2-macroglobulin MG5 domain
6	PF17962.3	1.0	2	597.0	opposite-strand	Bacterial macroglobulin domain 6