Result : Q92HD1

Protein Information

• Protein name: Putative uncharacterized protein RC0840
• NCBI Accession ID: AE006914.1
• Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)
• Left: 792937
• Right: 793095
• Strand: -
• Nucleotide Sequence: ATGATAGAGAAGCAGTTAATTGGACGTAAAGGTGACGGTGGATTTTATCGTTTATCGGTATCAAATGGCAAAAAGATTAAAGAAGTTATCAATATAAACGACTTATCATATAGTCCTGTTCAAAAAGTAGATATTTTGATCTTGATGCGCTTCTTGTAA
• Sequence: MIEKQLIGRKGDGGFYRLSVSNGKKIKEVININDLSYSPVQKVDILILMRFL
• Source of smORF: Swiss-Prot
• Pubmed ID: 11557893
• Functional Category: Others
• Uniprot ID: Q92HD1
• ORF Length (Amino Acid): 52

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	800542	800700	-	NC_016639.1	Rickettsia slovaca 13-B
2	792937	793095	-	NC_003103.1	Rickettsia conorii str. Malish 7
3	799059	799217	-	NC_010263.3	Rickettsia rickettsii str. Iowa

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_016639.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17973.3	1.0	3	1362	opposite-strand	Bacterial Alpha-2-macroglobulin MG10 domain
2	PF01835.21	0.67	2	1362.5	opposite-strand	MG2 domain
3	PF11974.10	0.67	2	1362.5	opposite-strand	Bacterial alpha-2-macroglobulin MG3 domain
4	PF00207.24	0.67	2	1362.5	opposite-strand	Alpha-2-macroglobulin family
5	PF17972.3	0.67	2	1362.5	opposite-strand	Bacterial Alpha-2-macroglobulin MG5 domain
6	PF17962.3	0.67	2	1362.5	opposite-strand	Bacterial macroglobulin domain 6