Protein name |
Putative ankyrin repeat protein RC0860 |
NCBI Accession ID |
AE006914.1 |
Organism |
Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left |
810640 |
Right |
810879 |
Strand |
+ |
Nucleotide Sequence |
GTGATGGATATCAATATTCAAGATTCGTTTTATCATACAGTTCTACATAAGGCTATTTACCGCAAACTTTATGATATAGCTGAATTTTTACTAGAAAAAGGAGCTTCAACAGAGTTAAAAGATTTAGATGGATATACACCTCTTCAATTAGTTATTCATGAAGGCTACACAGAAATGGTTAAATTTAATAATATGGAGCAGATCATCGAGATAAAAACTAATAGAATTAGTACCCGATGA |
Sequence |
MMDINIQDSFYHTVLHKAIYRKLYDIAEFLLEKGASTELKDLDGYTPLQLVIHEGYTEMVKFNNMEQIIEIKTNRISTR |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of pfam13637. Profile Description: Ankyrin repeats (many copies). **The ORF matches to the profile of cl02529. Profile Description: Ankyrin repeat. Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. |
Pubmed ID |
11557893
|
Domain |
CDD:372654,CDD:413359 |
Functional Category |
Others |
Uniprot ID |
Q92HB1
|
ORF Length (Amino Acid) |
79 |