Protein Information |
Information Type | Description |
---|---|
Protein name | Putative ankyrin repeat protein RC0877 |
NCBI Accession ID | AE006914.1 |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | 822816 |
Right | 823058 |
Strand | - |
Nucleotide Sequence | GTGGATCAAAGAAAATCCGGAGGAATACCTTTGCATGCGGTTGCTAAAAATGTTCGATGTACTTCTAAAGATATTAAGGATTATGAAATATATAAGCTGTTAGTATCATATGGTGCTGATATCAACGCAAGAGTAGAATTTACAGGAGTAGGGTTTAGTATATATGATGGAAAAACGATATCAGAAATAGTAGAATTTAAAATAGCATTCGTCGGTGAAAGTGAAGTAATAACGGAAGAATAA |
Sequence | MDQRKSGGIPLHAVAKNVRCTSKDIKDYEIYKLLVSYGADINARVEFTGVGFSIYDGKTISEIVEFKIAFVGESEVITEE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02529. Profile Description: Ankyrin repeat. Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. |
Pubmed ID | 11557893 |
Domain | CDD:413359 |
Functional Category | Others |
Uniprot ID | Q92H94 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 822816 | 823058 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
2 | 830816 | 831028 | - | NC_016639.1 | Rickettsia slovaca 13-B |
3 | 621410 | 621676 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
4 | 443848 | 444057 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07517.16 | 0.75 | 3 | 1126 | same-strand | SecA DEAD-like domain |
2 | PF07516.15 | 0.75 | 3 | 1126 | same-strand | SecA Wing and Scaffold domain |
3 | PF01043.22 | 0.75 | 3 | 1126 | same-strand | SecA preprotein cross-linking domain |
4 | PF02810.17 | 0.75 | 3 | 1126 | same-strand | SEC-C motif |
5 | PF13616.8 | 0.75 | 3 | 4062 | opposite-strand | PPIC-type PPIASE domain |
6 | PF00639.23 | 0.75 | 3 | 4062 | opposite-strand | PPIC-type PPIASE domain |
7 | PF13145.8 | 0.75 | 3 | 4062 | opposite-strand | PPIC-type PPIASE domain |
8 | PF01648.22 | 0.75 | 3 | 5120 | same-strand | 4'-phosphopantetheinyl transferase superfamily |