Protein Information |
Information Type | Description |
---|---|
Protein name | Histone-like DNA-binding protein |
NCBI Accession ID | AE006914.1 |
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Left | 1015018 |
Right | 1015305 |
Strand | - |
Nucleotide Sequence | ATGACTATTACCAAAGCAAAAATTGCAGCTATGTTAAGCTCTAAATTGGGTTTTTCAAATAATTTATGCGAGGAAATAGTTCATACGGTTTTTTCTAATATTTTAGAAATAGCAAAAGAGCAAAAATTAACTTTAAAGAATTTTGGTAGCTTTGAGGTGAAACAAAAAAATCCACGTCCCGGAATAAATTTTCATACCAAAGCACCGGTAATTATAGAATCAAAAAAGCATTTACGTTTTGTCCCTTCTTCTAAATTAAAAGCTTTAATTAATGAATCTACTCGATGA |
Sequence | MTITKAKIAAMLSSKLGFSNNLCEEIVHTVFSNILEIAKEQKLTLKNFGSFEVKQKNPRPGINFHTKAPVIIESKKHLRFVPSSKLKALINESTR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00257. Profile Description: DNA sequence specific (IHF) and non-specific (HU) domains. This model describes a set of proteins related to but longer than DNA-binding protein HU. Its distinctive domain architecture compared to HU and related histone-like DNA-binding proteins justifies the designation as superfamily. Members include, so far, one from Bacteroides fragilis, a gut bacterium, and ten from Porphyromonas gingivalis, an oral anaerobe. [DNA metabolism, Chromosome-associated proteins] |
Pubmed ID | 11557893 |
Domain | CDD:412265 |
Functional Category | DNA-binding |
Uniprot ID | Q92GN5 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1015018 | 1015305 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
2 | 1001262 | 1001549 | + | NC_016639.1 | Rickettsia slovaca 13-B |
3 | 1031296 | 1031583 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
4 | 1021786 | 1022073 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
5 | 421079 | 421369 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
6 | 1090160 | 1090450 | - | NZ_AP019563.1 | Rickettsia asiatica |
7 | 988794 | 989084 | - | NC_009881.1 | Rickettsia akari str. Hartford |
8 | 887239 | 887526 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
9 | 897800 | 898087 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
10 | 211711 | 211965 | + | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12334.10 | 0.8 | 8 | 2869.5 | same-strand | Rickettsia outer membrane protein B |
2 | PF03797.21 | 0.9 | 9 | 2876 | same-strand | Autotransporter beta-domain |
3 | PF00933.23 | 1.0 | 10 | 551.5 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
4 | PF00578.23 | 0.8 | 8 | 1089.0 | opposite-strand | AhpC/TSA family |
5 | PF08534.12 | 0.8 | 8 | 1089.0 | opposite-strand | Redoxin |
6 | PF03279.15 | 0.7 | 7 | 1681 | same-strand | Bacterial lipid A biosynthesis acyltransferase |
7 | PF02606.16 | 0.7 | 7 | 2528 | same-strand | Tetraacyldisaccharide-1-P 4'-kinase |
8 | PF01551.24 | 0.6 | 6 | 3503.5 | same-strand | Peptidase family M23 |
9 | PF04607.19 | 0.8 | 8 | 1807.0 | same-strand | Region found in RelA / SpoT proteins |