ProsmORF-pred
Result : Q92EC3
Protein Information
Information Type Description
Protein name UPF0237 protein lin0537
NCBI Accession ID AL596165.1
Organism Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Left 108542
Right 108811
Strand +
Nucleotide Sequence GTGAGAGCTGTACTTACTGTAATTGGAAAAGATAATGTGGGAATTGTCGCTGGAGTTAGTAATAAATTGGCAGAACTTAACATCAATATTGTCGACGTATCACAAACGATTATGGATGGATATTTTACGATGATGATGATGTGCGATATTAGCCAGATAACGAAAGAATTTGATGAAGTAAAAACAGAATTAACTGGAAAAGGTGAAGAACTCCAAGTAAAAATACATATTCAACGTGAAGAAATTTTTAACGCAATGCATAAACTATAG
Sequence MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMMMMCDISQITKEFDEVKTELTGKGEELQVKIHIQREEIFNAMHKL
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding.
Pubmed ID 11679669
Domain CDD:415594
Functional Category Others
Uniprot ID Q92EC3
ORF Length (Amino Acid) 89
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 149
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 531870 532139 + NZ_LT906444.1 Listeria welshimeri
2 570916 571185 + NC_003210.1 Listeria monocytogenes EGD-e
3 544918 545187 + NZ_CP009577.1 Listeria ivanovii subsp. ivanovii
4 474719 474988 + NC_013891.1 Listeria seeligeri serovar 1/2b str. SLCC3954
5 2944533 2944802 - NZ_CP011102.1 Listeria weihenstephanensis
6 2632083 2632352 + NZ_CP009709.1 Weizmannia coagulans DSM 1 = ATCC 7050
7 2247555 2247788 - NZ_LR134483.1 Listeria grayi
8 2964849 2965118 - NZ_AP021853.1 Sporolactobacillus terrae
9 395161 395430 + NZ_CP007445.1 Gilliamella apicola
10 1921246 1921515 - NZ_CP012024.1 Bacillus smithii
11 2013174 2013443 - NZ_CP009056.1 Frischella perrara
12 31453 31722 + NZ_CP021874.1 Enterococcus wangshanyuanii
13 3833686 3833997 + NZ_CP021874.1 Enterococcus wangshanyuanii
14 1723461 1723730 - NZ_CP012047.1 Tetragenococcus halophilus
15 1895104 1895373 - NZ_CP027286.1 Clostridium chauvoei
16 1572684 1572953 + NZ_CP017253.2 Clostridium taeniosporum
17 163332 163601 + NZ_CP017713.1 Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001
18 2684108 2684377 + NZ_CP071376.1 Clostridium gasigenes
19 2913549 2913818 + NZ_CP023671.1 Clostridium septicum
20 1542836 1543105 + NZ_CP027783.1 Tetragenococcus osmophilus
21 1270593 1270859 + NZ_AP022822.1 Enterococcus saigonensis
22 2861815 2862084 + NZ_CP009933.1 Clostridium scatologenes
23 1459014 1459283 - NZ_CP020953.1 Clostridium drakei
24 193048 193314 - NC_020208.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
25 1996866 1997135 - NZ_CP016786.1 Clostridium isatidis
26 350205 350474 - NZ_CP011803.1 Clostridium carboxidivorans P7
27 4584655 4584924 - NC_020291.1 Clostridium saccharoperbutylacetonicum N1-4(HMT)
28 1370822 1371091 + NZ_CP030775.1 Clostridium butyricum
29 66885 67154 + NZ_CP018180.1 Liquorilactobacillus nagelii
30 2639625 2639894 + NZ_CP043998.1 Clostridium diolis
31 1952728 1952994 - NC_020995.1 Enterococcus casseliflavus EC20
32 326413 326679 - NZ_CP023392.1 Lactococcus raffinolactis
33 552285 552554 + NC_015687.1 Clostridium acetobutylicum DSM 1731
34 2241438 2241707 - NZ_CP025197.1 Acetivibrio saccincola
35 2122168 2122437 - NZ_CP016502.1 Acetivibrio thermocellus DSM 2360
36 641657 641929 + NZ_CP042410.1 Leuconostoc citreum
37 2310279 2310545 - NZ_CP012034.1 Companilactobacillus ginsenosidimutans
38 839991 840260 + NZ_LT906477.1 Clostridium cochlearium
39 1002439 1002702 + NZ_CP070872.1 Lactococcus taiwanensis
40 2582433 2582738 + NC_015519.1 Tepidanaerobacter acetatoxydans Re1
41 1597134 1597400 - NZ_CP049366.1 Companilactobacillus pabuli
42 1973012 1973278 - NZ_CP017702.1 Companilactobacillus farciminis KCTC 3681 = DSM 20184
43 1293007 1293279 + NZ_AP012334.1 Scardovia inopinata JCM 12537
44 1619693 1619962 - NZ_CP014204.2 Clostridium baratii
45 3339319 3339591 - NZ_CP022464.2 Enterocloster bolteae
46 2071030 2071299 - NC_011898.1 Ruminiclostridium cellulolyticum H10
47 2023053 2023319 - NZ_CP031733.1 Streptococcus chenjunshii
48 963196 963459 + NC_022369.1 Lactococcus lactis subsp. cremoris KW2
49 182397 182666 + NZ_CP011403.1 Ligilactobacillus salivarius str. Ren
50 1406641 1406907 - NZ_CP017194.1 Lactococcus carnosus
51 1489575 1489841 - NZ_CP017195.1 Lactococcus paracarnosus
52 1726807 1727076 + NC_022571.1 Clostridium saccharobutylicum DSM 13864
53 1131840 1132109 + NZ_CP019870.1 Clostridioides difficile
54 1900858 1901124 - NZ_CP040736.1 Companilactobacillus futsaii
55 3527669 3527938 + NZ_CP040924.1 Clostridium thermarum
56 2488872 2489141 - NZ_CP061336.1 Ruminiclostridium herbifermentans
57 1576587 1576856 + NC_016627.1 Acetivibrio clariflavus DSM 19732
58 892683 892940 + NZ_CP014324.1 Oenococcus oeni
59 343415 343648 + NZ_CP027002.1 [Ruminococcus] gnavus ATCC 29149
60 1265271 1265540 - NZ_CP034465.1 Jeotgalibaca ciconiae
61 1557776 1558042 + NZ_LR134341.1 Streptococcus pseudoporcinus
62 918382 918654 + NC_018631.1 Leuconostoc gelidum JB7
63 202749 203021 - NC_014136.1 Leuconostoc kimchii IMSNU 11154
64 3212813 3213082 + NZ_CP021850.1 Pseudoclostridium thermosuccinogenes
65 2230518 2230784 + NZ_LT906439.1 Streptococcus merionis
66 910989 911270 + NZ_AP019750.1 Lactobacillus delbrueckii subsp. delbrueckii
67 2052772 2053041 + NC_016048.1 Oscillibacter valericigenes Sjm18-20
68 1051910 1052173 - NZ_CP032627.1 Lactococcus allomyrinae
69 1468200 1468451 + NZ_CP029684.2 Oenococcus sicerae
70 1520129 1520395 - NZ_CP013237.1 Streptococcus mutans
71 78842 79108 + NZ_AP014612.1 Streptococcus troglodytae
72 2404175 2404447 + NZ_CP039126.1 Blautia producta
73 1025082 1025351 - NZ_CP049740.1 Jeotgalibaca arthritidis
74 938836 939105 - NC_014122.1 Methanocaldococcus infernus ME
75 1216128 1216394 - NZ_CP012541.1 Campylobacter concisus
76 1798952 1799221 + NZ_CP018906.1 Lentilactobacillus curieae
77 329760 330026 + NZ_CP053831.1 Campylobacter mucosalis
78 1533382 1533651 - NZ_CP035807.1 Thiospirochaeta perfilievii
79 1705340 1705606 - NZ_CP014699.1 Streptococcus pantholopis
80 6445563 6445832 + NZ_CP048429.1 Paenibacillus jilunlii
81 1350390 1350665 - NC_007503.1 Carboxydothermus hydrogenoformans Z-2901
82 3372429 3372701 - NZ_AP023367.1 Anaerocolumna cellulosilytica
83 129962 130234 + NZ_CP070062.1 Coprococcus comes
84 1629232 1629498 - NZ_LR594050.1 Streptococcus porcinus
85 154651 154917 + NZ_CP029491.1 Streptococcus sobrinus
86 110181 110453 + NZ_CP009149.1 Methanocaldococcus bathoardescens
87 1646107 1646379 - NZ_AP012325.1 Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043
88 1435019 1435285 + NZ_CP012544.1 Campylobacter showae
89 1909528 1909797 + NC_014833.1 Ruminococcus albus 7 = DSM 20455
90 286766 287032 + NC_012924.1 Streptococcus suis SC84
91 572528 572794 + NZ_CP012559.1 Companilactobacillus heilongjiangensis
92 1328036 1328305 + NC_015732.1 Treponema caldarium DSM 7334
93 150073 150339 + NC_017581.1 Streptococcus thermophilus JIM 8232
94 266796 267062 + NZ_CP039457.1 Streptococcus pasteurianus
95 4394555 4394824 + NZ_CP014167.1 Paenibacillus yonginensis
96 1861474 1861740 - NZ_CP012196.1 Campylobacter gracilis
97 1405001 1405273 - NC_013156.1 Methanocaldococcus fervens AG86
98 248429 248701 - NZ_CP042374.1 Leuconostoc carnosum
99 2040595 2040867 - NZ_AP012326.1 Bifidobacterium dentium JCM 1195 = DSM 20436
100 540829 541098 - NZ_AP014680.1 Paucilactobacillus hokkaidonensis JCM 18461
101 658153 658422 + NZ_CP028107.1 Fusobacterium necrophorum subsp. funduliforme
102 121609 121875 + NZ_LR134275.1 Streptococcus vestibularis
103 4469953 4470222 + NZ_CP009428.1 Paenibacillus odorifer
104 749406 749672 + NZ_CP043405.1 Streptococcus ratti
105 681427 681693 + NZ_CP012543.1 Campylobacter rectus
106 1322981 1323250 + NZ_CP047121.1 Lentilactobacillus hilgardii
107 787717 787983 + NZ_AP012544.1 Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393
108 801935 802201 + NZ_LS991421.1 Lacticaseibacillus zeae
109 1127889 1128161 + NC_015636.1 Methanothermococcus okinawensis IH1
110 262238 262516 - NC_015555.1 Thermoanaerobacterium xylanolyticum LX-11
111 940686 940952 + NZ_CP032620.1 Streptococcus koreensis
112 2348377 2348610 + NZ_CP047602.1 Thermoanaerobacterium aotearoense
113 957270 957542 + NC_013921.1 Thermoanaerobacter italicus Ab9
114 2218778 2219047 + NZ_CP015756.1 Clostridium estertheticum subsp. estertheticum
115 951585 951863 + NZ_CP009170.1 Thermoanaerobacter kivui
116 545960 546232 + NZ_CP028251.1 Leuconostoc mesenteroides
117 974565 974837 + NC_014209.1 Thermoanaerobacter mathranii subsp. mathranii str. A3
118 1141234 1141506 - NZ_CP015247.1 Leuconostoc suionicum
119 2353905 2354174 + NC_014624.2 Eubacterium callanderi
120 986975 987244 + NZ_CP029487.1 Eubacterium maltosivorans
121 4106095 4106364 + NZ_CP019962.1 Eubacterium limosum
122 1080086 1080358 - NC_012778.1 [Eubacterium] eligens ATCC 27750
123 2499855 2500124 - NZ_CP032757.1 Lactiplantibacillus pentosus
124 1042483 1042758 - NC_014829.1 Evansella cellulosilytica DSM 2522
125 1113472 1113741 - NC_016894.1 Acetobacterium woodii DSM 1030
126 1562546 1562815 + NC_015578.1 Treponema primitia ZAS-2
127 1268282 1268548 - NZ_LS483306.1 Enterococcus cecorum
128 1534389 1534661 - NC_000909.1 Methanocaldococcus jannaschii DSM 2661
129 1811748 1812014 - NZ_CP041364.1 Schleiferilactobacillus harbinensis
130 94205 94474 - NZ_CP018796.1 Lentilactobacillus parabuchneri
131 1059979 1060245 + NZ_CP054015.1 Streptococcus gallolyticus
132 1094921 1095193 + NZ_CP068170.1 Erysipelatoclostridium ramosum
133 3829056 3829325 + NZ_CP009288.1 Paenibacillus durus
134 1578459 1578725 - NZ_CP012805.1 Streptococcus anginosus
135 1517165 1517431 - NZ_CP034543.1 Streptococcus periodonticum
136 343632 343910 - NC_014410.1 Thermoanaerobacterium thermosaccharolyticum DSM 571
137 1533063 1533329 - NZ_LS483436.1 Streptococcus intermedius
138 626889 627155 + NZ_CP022680.1 Streptococcus respiraculi
139 3617794 3618027 + NZ_CP048000.1 Anaerocolumna sedimenticola
140 424916 425182 - NZ_CP015196.1 Streptococcus marmotae
141 2230291 2230563 - NZ_CP032364.1 Lachnoanaerobaculum umeaense
142 1746970 1747248 + NC_014632.1 Ilyobacter polytropus DSM 2926
143 1475528 1475779 + NZ_CP040058.1 Anaerostipes rhamnosivorans
144 2068132 2068383 - NZ_CP036345.1 Anaerostipes caccae L1-92
145 1826956 1827225 + NC_008593.1 Clostridium novyi NT
146 1767170 1767439 + NZ_CP029971.1 Lentilactobacillus kefiri
147 1707543 1707794 + NC_015562.1 Methanotorris igneus Kol 5
148 2075520 2075795 + NZ_CP022278.1 Neisseria chenwenguii
149 952828 953094 + NZ_CP016953.1 Streptococcus himalayensis
150 1549749 1550021 + NC_009634.1 Methanococcus vannielii SB
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LT906444.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF05167.14 0.95 141 15 same-strand Uncharacterised ACR (DUF711)
++ More..