| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0435 protein lin1819 |
| NCBI Accession ID | AL596170.1 |
| Organism | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) |
| Left | 34585 |
| Right | 34806 |
| Strand | + |
| Nucleotide Sequence | ATGAATCTTGAAACCCCTTCACAGGAAAACTTAGATTTTATGTTAGCAGAAATTACTACTAAACTAAAAATGGTAAATGTTGGCGTTTTTGAAAATCTTGAGCTTGACTCTGTTGATTATAACGCACTTACTGATATTTATCAGCTAATTAAACGTAAATCAAATTTTAGCCCACGCGAAATGCAATTATTTGCAGAAGAGTTGCGTCGGATTAGAAAATAA |
| Sequence | MNLETPSQENLDFMLAEITTKLKMVNVGVFENLELDSVDYNALTDIYQLIKRKSNFSPREMQLFAEELRRIRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 11679669 |
| Domain | CDD:420123 |
| Functional Category | Others |
| Uniprot ID | Q92AV0 |
| ORF Length (Amino Acid) | 73 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1746478 | 1746699 | + | NZ_LT906444.1 | Listeria welshimeri |
| 2 | 1715985 | 1716206 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 3 | 1769479 | 1769700 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 4 | 1822724 | 1822945 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 5 | 2180163 | 2180384 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 6 | 1166214 | 1166435 | - | NZ_LR134483.1 | Listeria grayi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01938.22 | 0.83 | 5 | 2180 | opposite-strand | TRAM domain |
| 2 | PF02566.21 | 0.83 | 5 | 1738 | opposite-strand | OsmC-like protein |
| 3 | PF01712.21 | 0.83 | 5 | 988 | same-strand | Deoxynucleoside kinase |
| 4 | PF13238.8 | 0.83 | 5 | 988 | same-strand | AAA domain |
| 5 | PF03631.17 | 1.0 | 6 | 90.5 | opposite-strand | Virulence factor BrkB |
| 6 | PF02522.16 | 1.0 | 6 | 20.0 | opposite-strand | Aminoglycoside 3-N-acetyltransferase |
| 7 | PF00557.26 | 1.0 | 6 | 945.5 | opposite-strand | Metallopeptidase family M24 |
| 8 | PF00258.27 | 1.0 | 6 | 1892.0 | same-strand | Flavodoxin |
| 9 | PF02073.17 | 1.0 | 6 | 2481.0 | same-strand | Thermophilic metalloprotease (M29) |
| 10 | PF07690.18 | 0.83 | 5 | 3815 | same-strand | Major Facilitator Superfamily |