Result : Q92AQ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AL596170.1 |
| Organism | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) |
| Left | 90903 |
| Right | 91196 |
| Strand | - |
| Nucleotide Sequence | TTGTCAAATATATCCAAAGAAACAGTAGAAAAAGTAGCAAATCTTGCCAAACTAGAAGTATCAGAAACAGAAGCAACTGCTTTTGCTGGTCAGCTTGGTAAAATTATTGAGCTAGTGGAGCAATTAAATACACTAGATACAAACAATGTAGAGCCAACAAGCCATGCAATCGATGTATCGAATGTGTTACGTGAAGACGTAGCAACGAAAGGCCTTGATCGTAAAGAAGTACTGAAAAATGCGCCGGATCAACAAGACGGCATGTTCAAAGTACCAACAATAATGGAACAATAA |
| Sequence | MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTNNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDQQDGMFKVPTIMEQ |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 11679669 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q92AQ2 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 112
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1800787 | 1801080 | - | NZ_LT906444.1 | Listeria welshimeri |
| 2 | 1826411 | 1826704 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 3 | 1775588 | 1775881 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 4 | 1882491 | 1882784 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 5 | 1107103 | 1107396 | + | NZ_LR134483.1 | Listeria grayi |
| 6 | 2347617 | 2347910 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 7 | 734160 | 734450 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 8 | 1836372 | 1836662 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 9 | 695761 | 696051 | + | NZ_CP053989.1 | Niallia circulans |
| 10 | 1034043 | 1034333 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 11 | 999372 | 999662 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 12 | 2996529 | 2996819 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 13 | 2933193 | 2933483 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 14 | 308438 | 308728 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 15 | 3480741 | 3481031 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 16 | 2976100 | 2976390 | - | NZ_CP012024.1 | Bacillus smithii |
| 17 | 3677262 | 3677552 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 2736694 | 2736984 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 19 | 1795041 | 1795331 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 20 | 253220 | 253510 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 3803233 | 3803523 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 22 | 183522 | 183812 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 23 | 182843 | 183133 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 24 | 698631 | 698921 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 25 | 473080 | 473370 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 26 | 1400651 | 1400941 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 27 | 5168194 | 5168484 | - | NZ_CP026363.1 | Brevibacillus agri |
| 28 | 3548170 | 3548460 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 29 | 310543 | 310833 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 30 | 404943 | 405233 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 31 | 55131 | 55421 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 32 | 1992960 | 1993250 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 33 | 4095473 | 4095760 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 34 | 649993 | 650280 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 35 | 2167488 | 2167778 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 36 | 3153158 | 3153394 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 37 | 569354 | 569596 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 38 | 5493326 | 5493616 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 39 | 705836 | 706123 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 40 | 2747335 | 2747625 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 41 | 718070 | 718360 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 42 | 1275559 | 1275849 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 43 | 549853 | 550143 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 44 | 610161 | 610451 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 45 | 2900854 | 2901144 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 46 | 3880814 | 3881104 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 47 | 2404576 | 2404866 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 48 | 769763 | 770053 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 49 | 2384923 | 2385216 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 50 | 2151741 | 2152031 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 51 | 2134964 | 2135254 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 52 | 274483 | 274773 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 53 | 2638349 | 2638639 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 54 | 631764 | 632054 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 55 | 926112 | 926402 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 56 | 681876 | 682166 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 57 | 828283 | 828573 | - | NZ_CP043404.1 | Bacillus safensis |
| 58 | 569093 | 569383 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 59 | 1883388 | 1883687 | - | NZ_CP047361.1 | Macrococcus canis |
| 60 | 1359780 | 1360079 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 61 | 777526 | 777816 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 62 | 3256645 | 3256935 | - | NZ_CP011937.1 | Bacillus velezensis |
| 63 | 689611 | 689901 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 64 | 925124 | 925414 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 65 | 715878 | 716168 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 66 | 708097 | 708387 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 67 | 713632 | 713922 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 68 | 728732 | 729022 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 69 | 5693287 | 5693544 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 70 | 2862953 | 2863213 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 71 | 657806 | 658066 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 72 | 693192 | 693482 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 73 | 1281107 | 1281397 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 74 | 204376 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 75 | 2670026 | 2670322 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 76 | 3466783 | 3467022 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 77 | 2911633 | 2911920 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 78 | 903251 | 903541 | + | NZ_LS483476.1 | Lederbergia lentus |
| 79 | 2260877 | 2261137 | - | NZ_CP034118.1 | Staphylospora marina |
| 80 | 4782755 | 4783045 | - | NZ_CP040336.1 | Bacillus luti |
| 81 | 326615 | 326905 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 82 | 340515 | 340805 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 83 | 339909 | 340199 | + | NC_011725.1 | Bacillus cereus B4264 |
| 84 | 341953 | 342243 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 85 | 6801406 | 6801654 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 86 | 3435622 | 3435912 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 87 | 4795508 | 4795765 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 88 | 6312360 | 6312617 | - | NZ_CP034437.1 | Paenibacillus albus |
| 89 | 4964716 | 4964982 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 90 | 1721936 | 1722193 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 91 | 584387 | 584644 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 92 | 719464 | 719721 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 93 | 2301599 | 2301838 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 94 | 1015112 | 1015402 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 95 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 96 | 787800 | 788099 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 97 | 334609 | 334911 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 98 | 1966331 | 1966570 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 99 | 1428715 | 1429020 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 100 | 3669894 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 101 | 6157013 | 6157252 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 102 | 889589 | 889879 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 103 | 3462722 | 3462970 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 104 | 2521879 | 2522169 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 105 | 7675338 | 7675577 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 106 | 3366639 | 3366929 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 107 | 1059483 | 1059770 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 108 | 2399324 | 2399581 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 109 | 266154 | 266444 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 110 | 445096 | 445344 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 111 | 2874281 | 2874541 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 112 | 2347892 | 2348167 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906444.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 0.94 | 105 | 1486 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 0.94 | 105 | 1486 | same-strand | GatB domain |
| 3 | PF01425.23 | 0.95 | 106 | 15.0 | same-strand | Amidase |
++ More..