Result : Q8ZFG9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YPO1740/y2567/YP_1481 |
| NCBI Accession ID | AL590842.1 |
| Organism | Yersinia pestis |
| Left | 1984623 |
| Right | 1984898 |
| Strand | + |
| Nucleotide Sequence | ATGTTGGATACAAATATGAGCGCGTTTGGTGTCGCCTCAATCGCCTTACCGCTGCTTACCGTTCTTTTCTTCTTGATCGTTTGGTTTTTTTTGAGCCGGGCGAGCGTGCGGGCCAATGAACAGGTCCGGTTATTACGAGAAATTGCCGAGCAGCAAAAACGTCAGACAGAATTACTTACTGCATTACTGGAGAATGCCACGGGTACCCGTGACGGGCAGAACGACAGTGATACGGTTTCTCCTCTCGATTTCAAAGGCTTTATTCCAGAGCGATAA |
| Sequence | MLDTNMSAFGVASIALPLLTVLFFLIVWFFLSRASVRANEQVRLLREIAEQQKRQTELLTALLENATGTRDGQNDSDTVSPLDFKGFIPER |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13974. Profile Description: YebO-like protein. This short protein is uncharacterized. It seems likely to be of phage origin as it is found in Enterobacteria phage HK022 Gp20 and Enterobacteria phage HK97 Gp15. The protein is also found in a variety of enteric bacteria. |
| Pubmed ID | 11586360 12142430 15368893 |
| Domain | CDD:404798 |
| Functional Category | Others |
| Uniprot ID | Q8ZFG9 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2612357 | 2612632 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 2 | 3641349 | 3641624 | + | NZ_CP007230.1 | Yersinia similis |
| 3 | 859904 | 860179 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 4 | 2580910 | 2581185 | - | NZ_CP046293.1 | Yersinia intermedia |
| 5 | 3205454 | 3205729 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 6 | 942118 | 942393 | - | NZ_CP009787.1 | Yersinia rohdei |
| 7 | 2015802 | 2016077 | + | NZ_CP043727.1 | Yersinia canariae |
| 8 | 1994077 | 1994352 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 9 | 1471416 | 1471691 | + | NZ_CP032487.1 | Yersinia hibernica |
| 10 | 691674 | 691949 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 11 | 1933616 | 1933888 | - | NZ_CP067057.1 | Rahnella aceris |
| 12 | 5289085 | 5289366 | - | NZ_CP011254.1 | Serratia fonticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007230.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07017.13 | 0.83 | 10 | 2718.0 | opposite-strand | Antimicrobial peptide resistance and lipid A acylation protein PagP |
| 2 | PF00324.23 | 0.92 | 11 | 1075 | same-strand | Amino acid permease |
| 3 | PF13520.8 | 0.92 | 11 | 1075 | same-strand | Amino acid permease |
| 4 | PF13269.8 | 1.0 | 12 | 624.0 | same-strand | Protein of unknown function (DUF4060) |
| 5 | PF13996.8 | 0.92 | 11 | 542 | opposite-strand | YobH-like protein |
| 6 | PF10964.10 | 1.0 | 12 | 872.0 | same-strand | Protein of unknown function (DUF2766) |
| 7 | PF12833.9 | 0.83 | 10 | 1775.5 | opposite-strand | Helix-turn-helix domain |
| 8 | PF00165.25 | 0.83 | 10 | 1775.5 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 9 | PF10736.11 | 0.67 | 8 | 4321.0 | same-strand | Protein of unknown function (DUF2627) |
++ More..