Result : Q8ZE65
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acid shock protein 1 |
| NCBI Accession ID | AL590842.1 |
| Organism | Yersinia pestis |
| Left | 2606217 |
| Right | 2606501 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACAGTATTGACTCTGATTGTTGCTGCAACCCTGAGTTTATTCTCTGTTGCTTTTGCAGCCGACACAGTAGTACCGCAAACCACACCAACGGCGACAGCACCAGCACCAGCAGTGCATAACGCATCAGCTAAAACCATGCACCACAAAAAAGCACAAAAACCAAACACAATAAAAAATACGCATAAAACCGCCCCTGAACAAAAAGCCCAGGCAGCCCAAAAACACCATAAAGCGGCACATAGCCACAAAGCACCTACCGTAGCACCAGCGGCTAAATAG |
| Sequence | MKTVLTLIVAATLSLFSVAFAADTVVPQTTPTATAPAPAVHNASAKTMHHKKAQKPNTIKNTHKTAPEQKAQAAQKHHKAAHSHKAPTVAPAAK |
| Source of smORF | Swiss-Prot |
| Function | Required for growth and/or survival at acidic conditions. {ECO:0000250}. |
| Pubmed ID | 11586360 12142430 15368893 |
| Domain | CDD:235132 |
| Functional Category | Others |
| Uniprot ID | Q8ZE65 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2021129 | 2021407 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 2 | 4227400 | 4227678 | + | NZ_CP007230.1 | Yersinia similis |
| 3 | 2261561 | 2261836 | - | NZ_CP043727.1 | Yersinia canariae |
| 4 | 710103 | 710393 | + | NZ_CP009787.1 | Yersinia rohdei |
| 5 | 395647 | 395922 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 6 | 3568322 | 3568597 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 7 | 1779158 | 1779433 | - | NZ_CP032487.1 | Yersinia hibernica |
| 8 | 447863 | 448105 | + | NZ_CP011078.1 | Yersinia ruckeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009787.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02525.19 | 0.75 | 6 | 6517.0 | same-strand | Flavodoxin-like fold |
| 2 | PF03358.17 | 0.75 | 6 | 6517.0 | same-strand | NADPH-dependent FMN reductase |
| 3 | PF11898.10 | 0.88 | 7 | 2241 | opposite-strand | Domain of unknown function (DUF3418) |
| 4 | PF07717.18 | 0.88 | 7 | 2241 | opposite-strand | Oligonucleotide/oligosaccharide-binding (OB)-fold |
| 5 | PF00271.33 | 0.88 | 7 | 2241 | opposite-strand | Helicase conserved C-terminal domain |
| 6 | PF00270.31 | 0.88 | 7 | 2241 | opposite-strand | DEAD/DEAH box helicase |
| 7 | PF05973.16 | 0.88 | 7 | 1593 | opposite-strand | Phage derived protein Gp49-like (DUF891) |
| 8 | PF01381.24 | 0.88 | 7 | 1273 | opposite-strand | Helix-turn-helix |
| 9 | PF00089.28 | 1.0 | 8 | 364.0 | same-strand | Trypsin |
| 10 | PF13365.8 | 1.0 | 8 | 364.0 | same-strand | Trypsin-like peptidase domain |
| 11 | PF02074.17 | 0.88 | 7 | 539 | same-strand | Carboxypeptidase Taq (M32) metallopeptidase |
| 12 | PF02518.28 | 0.88 | 7 | 2055 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 13 | PF00672.27 | 0.75 | 6 | 2040.5 | same-strand | HAMP domain |
| 14 | PF00512.27 | 0.88 | 7 | 2055 | same-strand | His Kinase A (phospho-acceptor) domain |
| 15 | PF00486.30 | 0.62 | 5 | 3330 | same-strand | Transcriptional regulatory protein, C terminal |
| 16 | PF00072.26 | 0.62 | 5 | 3330 | same-strand | Response regulator receiver domain |
++ More..