Result : Q8Z7J8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YceQ |
| NCBI Accession ID | AL513382.1 |
| Organism | Salmonella typhi |
| Left | 1182681 |
| Right | 1182929 |
| Strand | + |
| Nucleotide Sequence | GTGTCGGTTGCCTGTATTTCATACGGAAACACAGCGCAATTATCAGGGAAGCAGCCTGGGCATTACTCTCCAGAGAAGATCCTATCTACCGGTAAGGACTGCAACCCGCAGCCCGCTAACTGTCTGAAAAATCAATACGTCTTACGCCATTGCTGCGTTGATGATCGGTCAGACAAAATGGGTTATTCCGCTAAACTTTTTGTTTTAACAAGTTTCGGTGCGGAAACCGCATCATTATTCCACTGCTAA |
| Sequence | MSVACISYGNTAQLSGKQPGHYSPEKILSTGKDCNPQPANCLKNQYVLRHCCVDDRSDKMGYSAKLFVLTSFGAETASLFHC |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11677608 12644504 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q8Z7J8 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1271683 | 1271931 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3663061 | 3663309 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 3632131 | 3632379 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 4 | 882566 | 882775 | - | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053416.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00460.22 | 1.0 | 4 | 5633.5 | same-strand | Flagella basal body rod protein |
| 2 | PF00669.22 | 1.0 | 4 | 4665.5 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF10150.11 | 1.0 | 4 | 136.0 | opposite-strand | Ribonuclease E/G family |
| 4 | PF12111.10 | 1.0 | 4 | 136.0 | opposite-strand | Polyribonucleotide phosphorylase C terminal |
| 5 | PF00575.25 | 1.0 | 4 | 136.0 | opposite-strand | S1 RNA binding domain |
| 6 | PF00849.24 | 1.0 | 4 | 148.5 | same-strand | RNA pseudouridylate synthase |
| 7 | PF01479.27 | 1.0 | 4 | 148.5 | same-strand | S4 domain |
| 8 | PF02545.16 | 1.0 | 4 | 1258.0 | opposite-strand | Maf-like protein |
| 9 | PF02620.19 | 1.0 | 4 | 2040.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 10 | PF01783.25 | 0.75 | 3 | 2586 | same-strand | Ribosomal L32p protein family |
| 11 | PF02504.17 | 0.75 | 3 | 2840 | same-strand | Fatty acid synthesis protein |
++ More..