Result : Q8Z5N3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cobalt transport protein CbiN (Energy-coupling factor transporter probable substrate-capture protein CbiN) (ECF transporter S component CbiN) |
| NCBI Accession ID | AL513382.1 |
| Organism | Salmonella typhi |
| Left | 2059418 |
| Right | 2059699 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAAACGTTGATGTTGTTAGCGATGGTGGTGGCGCTGGTGATTCTGCCGTTTTTTATTAACCATGGCGGTGAATATGGCGGTTCAGACGGCGAAGCGGAAAGCCAGATTCAGGCTCTTGCGCCGCAGTATAAACCTTGGTTTCAGCCGTTATATGAACCCGCCAGCGGTGAAATTGAAAGCCTGCTGTTTACCCTTCAGGGCTCTCTTGGCGCGGCGGTGATTTTTTATATCCTGGGGTATTGCAAAGGTAAACAACGCCGTGATGACCGGGCTTGA |
| Sequence | MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQALAPQYKPWFQPLYEPASGEIESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA |
| Source of smORF | Swiss-Prot |
| Function | Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import. {ECO:0000255|HAMAP-Rule:MF_00330}. |
| Pubmed ID | 11677608 12644504 |
| Domain | CDD:412601 |
| Functional Category | Others |
| Uniprot ID | Q8Z5N3 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 63
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2102684 | 2102965 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 759579 | 759860 | - | NZ_CP033744.1 | Citrobacter freundii |
| 3 | 4341087 | 4341368 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 4 | 4308592 | 4308873 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 498648 | 498929 | + | NZ_CP038469.1 | Citrobacter tructae |
| 6 | 2210691 | 2210972 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 7 | 2394519 | 2394800 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 8 | 943026 | 943307 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 9 | 782470 | 782751 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 950227 | 950508 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 11 | 2536186 | 2536467 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 1156626 | 1156907 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 13 | 1062408 | 1062689 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 14 | 4286663 | 4286944 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 15 | 2824350 | 2824631 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 16 | 1045724 | 1046005 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 17 | 962262 | 962543 | + | NZ_CP054254.1 | Klebsiella variicola |
| 18 | 2728955 | 2729236 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 19 | 1960508 | 1960789 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 20 | 3220123 | 3220404 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 21 | 3001026 | 3001307 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 22 | 2967972 | 2968253 | - | NZ_CP043727.1 | Yersinia canariae |
| 23 | 2404981 | 2405262 | - | NZ_CP032487.1 | Yersinia hibernica |
| 24 | 111725 | 112006 | + | NZ_CP009787.1 | Yersinia rohdei |
| 25 | 1699007 | 1699288 | + | NZ_CP046293.1 | Yersinia intermedia |
| 26 | 4423892 | 4424173 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 27 | 3021846 | 3022127 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 28 | 1683488 | 1683769 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 29 | 2602301 | 2602582 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 30 | 1672056 | 1672337 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 31 | 988834 | 989115 | + | NZ_CP050150.1 | Hafnia alvei |
| 32 | 1837523 | 1837807 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 33 | 2397263 | 2397544 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 34 | 3889038 | 3889319 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 35 | 857779 | 858060 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 36 | 1557128 | 1557409 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 37 | 1340360 | 1340650 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 38 | 1112652 | 1112897 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 39 | 2786210 | 2786482 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 40 | 1887267 | 1887539 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 41 | 1229045 | 1229290 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 42 | 1229785 | 1230030 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 43 | 1827400 | 1827660 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 44 | 1170089 | 1170334 | + | NZ_LT906444.1 | Listeria welshimeri |
| 45 | 224372 | 224656 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 46 | 2379789 | 2380025 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 47 | 3305765 | 3306088 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 48 | 1827567 | 1827800 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 49 | 941115 | 941396 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 50 | 1217285 | 1217527 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 51 | 1145418 | 1145648 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 52 | 4251957 | 4252184 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 53 | 1128482 | 1128727 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 54 | 851294 | 851548 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 55 | 1897249 | 1897521 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 56 | 2111402 | 2111629 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 57 | 1808414 | 1808668 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 58 | 2803790 | 2804029 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 59 | 1668555 | 1668830 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 60 | 200405 | 200659 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 61 | 1807976 | 1808221 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 62 | 127895 | 128164 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 63 | 3252979 | 3253227 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07685.16 | 0.71 | 45 | 1488 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 2 | PF13500.8 | 0.7 | 44 | 1488.0 | same-strand | AAA domain |
| 3 | PF01656.25 | 0.73 | 46 | 1488.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 4 | PF00005.29 | 0.98 | 62 | 676 | same-strand | ABC transporter |
| 5 | PF02463.21 | 0.73 | 46 | 676 | same-strand | RecF/RecN/SMC N terminal domain |
| 6 | PF02361.18 | 0.95 | 60 | -13.0 | same-strand | Cobalt transport protein |
| 7 | PF01891.18 | 1.0 | 63 | 2 | same-strand | Cobalt uptake substrate-specific transmembrane region |
| 8 | PF00590.22 | 0.78 | 49 | 2023 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 9 | PF06180.13 | 0.71 | 45 | 1455 | same-strand | Cobalt chelatase (CbiK) |
| 10 | PF02571.16 | 0.78 | 49 | 2261 | same-strand | Precorrin-6x reductase CbiJ/CobK |
++ More..