Result : Q8YYG7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein M (PSII-M) |
| NCBI Accession ID | BA000019.2 |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | 1019083 |
| Right | 1019199 |
| Strand | - |
| Nucleotide Sequence | ATGCAAGTTAATGACTTAGGGTTCGTAGCGAGCATTCTGTTCGTACTAGTACCCTCTGTGTTTTTAATAATTCTGTACATTCAAACAGCCAGCCGCGAAGGTAAAAAAGATAGTTGA |
| Sequence | MQVNDLGFVASILFVLVPSVFLIILYIQTASREGKKDS |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface. {ECO:0000255|HAMAP-Rule:MF_00438}. |
| Pubmed ID | 11759840 |
| Domain | CDD:177019 |
| Functional Category | Others |
| Uniprot ID | Q8YYG7 |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 554250 | 554366 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 6291365 | 6291478 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 3 | 1612288 | 1612404 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 4 | 6504735 | 6504851 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 5 | 176863 | 176979 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 6 | 518336 | 518449 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 7 | 347830 | 347946 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 8 | 4965467 | 4965580 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 9 | 1676157 | 1676270 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 10 | 1899379 | 1899495 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 11 | 4824351 | 4824464 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 12 | 3302274 | 3302384 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 13 | 1601073 | 1601180 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 14 | 1808759 | 1808869 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 15 | 1944267 | 1944371 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 16 | 3829349 | 3829456 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 17 | 617367 | 617477 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 18 | 4436796 | 4436903 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 19 | 2439965 | 2440072 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 20 | 2086206 | 2086313 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 21 | 3892302 | 3892409 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 22 | 525147 | 525254 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 23 | 2381064 | 2381174 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 24 | 4893280 | 4893387 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 25 | 2134310 | 2134420 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 26 | 2301482 | 2301592 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 27 | 2015226 | 2015330 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00582.28 | 0.63 | 17 | 137 | opposite-strand | Universal stress protein family |
| 2 | PF00111.29 | 0.78 | 21 | 137 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
++ More..