Result : Q8YVQ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b6-f complex subunit 6 (Cytochrome b6-f complex subunit PetL) (Cytochrome b6-f complex subunit VI) |
| NCBI Accession ID | BA000019.2 |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | 2304865 |
| Right | 2304960 |
| Strand | - |
| Nucleotide Sequence | ATGTTGGCAATAGTAGCTTATATCGGCTTTTTGGCTTTGTTCACTGGCATAGCTGCTGGTCTGCTGTTTGGTTTACGCTCTGCGAAGATACTGTAG |
| Sequence | MLAIVAYIGFLALFTGIAAGLLFGLRSAKIL |
| Source of smORF | Swiss-Prot |
| Function | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex. {ECO:0000255|HAMAP-Rule:MF_00433}. |
| Pubmed ID | 11759840 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q8YVQ2 |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 433698 | 433793 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 3427876 | 3427971 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 3 | 3556764 | 3556859 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 4 | 7085055 | 7085150 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 5 | 1915382 | 1915474 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 6 | 5305079 | 5305171 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 7 | 3825487 | 3825579 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 8 | 6604570 | 6604665 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 9 | 1985774 | 1985869 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 10 | 4482989 | 4483084 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 11 | 93804 | 93899 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 12 | 907697 | 907789 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 13 | 1623092 | 1623193 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 14 | 791542 | 791637 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 15 | 1326963 | 1327058 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01761.22 | 0.6 | 9 | 154 | opposite-strand | 3-dehydroquinate synthase |
++ More..