Result : Q8YQH9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein J (PSII-J) |
| NCBI Accession ID | BA000019.2 |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | 4644621 |
| Right | 4644743 |
| Strand | + |
| Nucleotide Sequence | GTGTCTGCTGGAAGTGGGAGAATTCCCCTGTGGGTCGTCGCTACGATCGCAGGTTTAGGTGTAATTACGGTTGTAGGTATCTTCTTCTATGGAGCCTACGCTGGAATCGGTTCTTCAATATAA |
| Sequence | MSAGSGRIPLWVVATIAGLGVITVVGIFFYGAYAGIGSSI |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_01305}. |
| Pubmed ID | 11759840 |
| Domain | CDD:421512 |
| Functional Category | Others |
| Uniprot ID | Q8YQH9 |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3586991 | 3587113 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 2274865 | 2274984 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 3 | 1312492 | 1312611 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 4 | 3386133 | 3386252 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 5 | 6854672 | 6854791 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 6 | 1496289 | 1496408 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 7 | 4428806 | 4428925 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 8 | 978656 | 978775 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 9 | 2999786 | 2999905 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 10 | 969358 | 969477 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 11 | 4983765 | 4983884 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 12 | 1353813 | 1353932 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 13 | 1610882 | 1611004 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 14 | 1488429 | 1488551 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 15 | 3011951 | 3012070 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 16 | 904960 | 905079 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 17 | 2182428 | 2182547 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 18 | 2036079 | 2036192 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 19 | 5254454 | 5254573 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 20 | 3492040 | 3492159 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 21 | 856385 | 856501 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 22 | 3740136 | 3740258 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 23 | 1432591 | 1432710 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 24 | 2668179 | 2668295 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 25 | 3375795 | 3375911 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 26 | 3372834 | 3372944 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 27 | 906270 | 906380 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 28 | 2067890 | 2068021 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00284.22 | 1.0 | 28 | 342.5 | same-strand | Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit |
| 2 | PF00283.21 | 1.0 | 28 | 314.5 | same-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
| 3 | PF14870.8 | 0.86 | 24 | 727.0 | same-strand | Photosynthesis system II assembly factor YCF48 |
| 4 | PF00301.22 | 0.86 | 24 | 1862.5 | same-strand | Rubredoxin |
++ More..