Result : Q8YQ90
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cobalt transport protein CbiN (Energy-coupling factor transporter probable substrate-capture protein CbiN) (ECF transporter S component CbiN) |
| NCBI Accession ID | BA000019.2 |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | 4762542 |
| Right | 4762844 |
| Strand | + |
| Nucleotide Sequence | ATGAATCAATCTAAACAAAGCCTCAGTAATTGGCTATTGATAGGCGGAGTCATCGCTTTAGCCGTTTTACCTTTAATATTTGTGCGGGATGCAGAATTTACAGGTGCAGATAGCCAAGCCGAAAAAGCAATTAGTGAGGTGAAGCCTGGATATGAACCTTGGTTTAAACCGTTATTTGAACCACCAAGCGGTGAAGTGGAAAGTTTATTATTCAGTTCACAAGCAGCTTTAGGCGCGGGGATTATTGGTTATGCAGTTGGTTTATATAAGGGACGTTCCCAACAGCAAAGGCATAAGGAATGA |
| Sequence | MNQSKQSLSNWLLIGGVIALAVLPLIFVRDAEFTGADSQAEKAISEVKPGYEPWFKPLFEPPSGEVESLLFSSQAALGAGIIGYAVGLYKGRSQQQRHKE |
| Source of smORF | Swiss-Prot |
| Function | Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import. {ECO:0000255|HAMAP-Rule:MF_00330}. |
| Pubmed ID | 11759840 |
| Domain | CDD:412601 |
| Functional Category | Others |
| Uniprot ID | Q8YQ90 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3469116 | 3469418 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 417132 | 417434 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 3 | 3063124 | 3063426 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 4 | 7222878 | 7223144 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 5 | 851294 | 851548 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 6 | 1447992 | 1448249 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 7 | 1182198 | 1182482 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 8 | 4251888 | 4252184 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 9 | 556604 | 556924 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 10 | 1827534 | 1827800 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 11 | 3305765 | 3306088 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 12 | 1833053 | 1833346 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 13 | 1527223 | 1527477 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 14 | 499399 | 499656 | - | NC_014122.1 | Methanocaldococcus infernus ME |
| 15 | 2555322 | 2555624 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 16 | 126538 | 126840 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 17 | 468507 | 468794 | + | NC_008593.1 | Clostridium novyi NT |
| 18 | 1353068 | 1353334 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 19 | 3408336 | 3408593 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 20 | 1799778 | 1800065 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 21 | 941154 | 941396 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 22 | 2178924 | 2179166 | - | NZ_CP014204.2 | Clostridium baratii |
| 23 | 412042 | 412335 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 24 | 2786240 | 2786482 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 25 | 1887267 | 1887509 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 26 | 565690 | 565992 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 27 | 407366 | 407623 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 28 | 1113981 | 1114226 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 29 | 2143063 | 2143326 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 30 | 39401 | 39649 | + | NZ_CP009149.1 | Methanocaldococcus bathoardescens |
| 31 | 3694046 | 3694303 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 32 | 834026 | 834268 | + | NC_015562.1 | Methanotorris igneus Kol 5 |
| 33 | 2355703 | 2356044 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 34 | 1268117 | 1268365 | + | NC_013156.1 | Methanocaldococcus fervens AG86 |
| 35 | 988873 | 989115 | + | NZ_CP050150.1 | Hafnia alvei |
| 36 | 1128482 | 1128727 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 37 | 1153312 | 1153593 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 38 | 782500 | 782751 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 39 | 4308592 | 4308834 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 40 | 2023782 | 2024039 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 41 | 1102735 | 1103013 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 42 | 4541754 | 4541999 | - | NZ_CP036401.1 | Massilia albidiflava |
| 43 | 1679528 | 1679773 | + | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 44 | 200405 | 200659 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 45 | 1320387 | 1320656 | + | NZ_CP009501.1 | Methanosarcina thermophila TM-1 |
| 46 | 2515223 | 2515498 | - | NZ_CP032683.1 | Methanosarcina flavescens |
| 47 | 2316976 | 2317260 | - | NZ_CP070511.1 | Parageobacillus toebii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.89 | 42 | 778 | same-strand | ABC transporter |
| 2 | PF02361.18 | 0.94 | 44 | -3 | same-strand | Cobalt transport protein |
| 3 | PF01891.18 | 0.98 | 46 | 35 | same-strand | Cobalt uptake substrate-specific transmembrane region |
++ More..