ProsmORF-pred
Result : Q8YNB4
Protein Information
Information Type Description
Protein name UPF0337 protein asr4653
NCBI Accession ID BA000019.2
Organism Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Left 5555144
Right 5555326
Strand +
Nucleotide Sequence ATGAGTACTGAAAAAAGAATTGAAGCAACTGCTAAAAATATCGAAGGTAAATTACAAGAAGTAATTGGCGAAGTAACTGGGAATCCATCAGATAAAGCAGAGGGTAAAGCTAAACAAGCTGAATCTCAGGTTATCCATACTACAGAAAATATCAAGGATGAATTGAAGAAGGCTATTGACTAA
Sequence MSTEKRIEATAKNIEGKLQEVIGEVTGNPSDKAEGKAKQAESQVIHTTENIKDELKKAID
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional
Pubmed ID 11759840
Domain CDD:419889
Functional Category Others
Uniprot ID Q8YNB4
ORF Length (Amino Acid) 60
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 21
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3770030 3770212 - NZ_CP047242.1 Trichormus variabilis 0441
2 777426 777608 - NZ_CP047242.1 Trichormus variabilis 0441
3 113806 113988 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
4 471540 471722 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
5 4736215 4736397 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
6 4046473 4046655 - NC_010628.1 Nostoc punctiforme PCC 73102
7 1131334 1131516 - NC_010628.1 Nostoc punctiforme PCC 73102
8 571267 571449 + NC_010628.1 Nostoc punctiforme PCC 73102
9 5850005 5850187 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
10 3593737 3593919 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
11 5268873 5269055 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
12 4970119 4970301 + NC_011729.1 Gloeothece citriformis PCC 7424
13 5837063 5837245 + NC_011729.1 Gloeothece citriformis PCC 7424
14 1549836 1550018 + NC_019748.1 Stanieria cyanosphaera PCC 7437
15 1549580 1549762 + NC_019748.1 Stanieria cyanosphaera PCC 7437
16 1549347 1549529 + NC_019748.1 Stanieria cyanosphaera PCC 7437
17 3621886 3622056 - NC_019748.1 Stanieria cyanosphaera PCC 7437
18 3239125 3239307 - NC_019689.1 Pleurocapsa sp. PCC 7327
19 388358 388546 + NC_019689.1 Pleurocapsa sp. PCC 7327
20 2382318 2382500 + NZ_CP031941.1 Nostoc sphaeroides
21 1151470 1151652 + NZ_CP031941.1 Nostoc sphaeroides
22 4834203 4834385 + NC_019771.1 Anabaena cylindrica PCC 7122
23 2093358 2093540 - NC_019771.1 Anabaena cylindrica PCC 7122
24 5053378 5053560 - NC_009925.1 Acaryochloris marina MBIC11017
25 5920365 5920547 - NC_019751.1 Calothrix sp. PCC 6303
26 5919829 5920011 - NC_019751.1 Calothrix sp. PCC 6303
27 5920096 5920278 - NC_019751.1 Calothrix sp. PCC 6303
28 1655461 1655640 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
29 4906996 4907187 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
30 228996 229178 + NC_014501.1 Gloeothece verrucosa PCC 7822
31 2337435 2337617 + NC_014501.1 Gloeothece verrucosa PCC 7822
32 2666683 2666865 - NC_010296.1 Microcystis aeruginosa NIES-843
33 2665914 2666096 - NC_010296.1 Microcystis aeruginosa NIES-843
34 3133098 3133280 - NC_019693.1 Oscillatoria acuminata PCC 6304
35 3133510 3133707 - NC_019693.1 Oscillatoria acuminata PCC 6304
36 2015236 2015424 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
37 7360838 7361020 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
38 3325044 3325226 - NC_014248.1 'Nostoc azollae' 0708
39 5119940 5120122 - NC_019753.1 Crinalium epipsammum PCC 9333
40 3931915 3932103 - NC_019753.1 Crinalium epipsammum PCC 9333
41 3241098 3241286 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
42 3966008 3966196 + NC_022600.1 Gloeobacter kilaueensis JS1
43 2520886 2521068 + NC_019675.1 Cyanobium gracile PCC 6307
++ More..