Result : Q8YLK8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit PsaK 2 (Photosystem I subunit X 2) |
| NCBI Accession ID | |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLSSILLAAQATVPNTGTTWNWNGTPIIIASCLLVLLIAGRSIRYPHVGTKMPLPFPSIFNNPSVATFLAAMSFGHIIGVAAVLGLTNLGVI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11425. Profile Description: Photosystem I psaG / psaK. Members of this protein family are the PsaK of the photosystem I reaction center. Photosystems I and II occur together in the same sets of organisms. Photosystem I uses light energy to transfer electrons from plastocyanin to ferredoxin, while photosystem II uses light energy to split water and releases molecular oxygen. [Energy metabolism, Photosynthesis] |
| Pubmed ID | 11759840 |
| Domain | CDD:416266 |
| Functional Category | Others |
| Uniprot ID | Q8YLK8 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4415307 | 4415585 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 3444450 | 3444725 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 3 | 2091614 | 2091892 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 4 | 2092153 | 2092407 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 5 | 3006214 | 3006492 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 6 | 3005693 | 3005947 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 7 | 1574954 | 1575229 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 8 | 1574446 | 1574724 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 9 | 4019740 | 4019985 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 10 | 349669 | 349947 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 11 | 4678107 | 4678361 | + | NZ_CP031941.1 | Nostoc sphaeroides |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00697.24 | 0.75 | 6 | 627 | opposite-strand | N-(5'phosphoribosyl)anthranilate (PRA) isomerase |
| 2 | PF01241.20 | 0.62 | 5 | 261 | same-strand | Photosystem I psaG / psaK |
++ More..