| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AL591978.1 |
| Organism | Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) |
| Left | 225704 |
| Right | 225931 |
| Strand | + |
| Nucleotide Sequence | GTGGCAACTAAAAAGAAAACTTTTGAAGAAGCAATTGCAGAATTAGAAACAATCGTAGAAGCACTCGAAAATGGTAGTGCCTCACTTGAAGATTCTCTCGATATGTACCAAAAAGGAATCGAACTAACAAAATTGTGCCAAGATAAATTACAATCAGCCGAAAAACGAATGGCAAAAGTAGTCACAGATGCAGGAGAAGAAATTCCTTTTGAAGCGGATGGTGAATAA |
| Sequence | MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 11679669 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q8Y7C3 |
| ORF Length (Amino Acid) | 75 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1385704 | 1385931 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 2 | 1294932 | 1295159 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 3 | 1364240 | 1364467 | + | NZ_LT906444.1 | Listeria welshimeri |
| 4 | 1412089 | 1412316 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 5 | 1299623 | 1299850 | + | NZ_LR134483.1 | Listeria grayi |
| 6 | 1770675 | 1770908 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 7 | 604576 | 604770 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 8 | 599265 | 599495 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 9 | 1658051 | 1658290 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 10 | 2666528 | 2666728 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 11 | 1690905 | 1691129 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 12 | 3335690 | 3335929 | - | NZ_CP053989.1 | Niallia circulans |
| 13 | 1946765 | 1946962 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 14 | 1486017 | 1486202 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 15 | 10320 | 10532 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 16 | 1771969 | 1772169 | + | NZ_LS483476.1 | Lederbergia lentus |
| 17 | 2194305 | 2194490 | - | NZ_CP012024.1 | Bacillus smithii |
| 18 | 2130346 | 2130612 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 19 | 2183686 | 2183928 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 20 | 3017554 | 3017799 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 21 | 2632503 | 2632748 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 22 | 956655 | 956867 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 23 | 1113848 | 1114060 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 24 | 865197 | 865433 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 25 | 1415908 | 1416123 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 26 | 2260501 | 2260737 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 27 | 1542492 | 1542746 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 28 | 501958 | 502173 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03780.15 | 0.71 | 20 | 2733.5 | same-strand | Asp23 family, cell envelope-related function |
| 2 | PF01029.20 | 0.71 | 20 | 2311.5 | same-strand | NusB family |
| 3 | PF02882.21 | 0.68 | 19 | 1361 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 4 | PF00763.25 | 0.68 | 19 | 1361 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 5 | PF02601.17 | 0.82 | 23 | 2 | same-strand | Exonuclease VII, large subunit |
| 6 | PF13742.8 | 0.86 | 24 | 2.0 | same-strand | OB-fold nucleic acid binding domain |
| 7 | PF01336.27 | 0.86 | 24 | 2.0 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF00348.19 | 1.0 | 28 | 0 | same-strand | Polyprenyl synthetase |
| 9 | PF01728.21 | 0.86 | 24 | 1980.0 | same-strand | FtsJ-like methyltransferase |
| 10 | PF01316.23 | 0.82 | 23 | 1904 | same-strand | Arginine repressor, DNA binding domain |
| 11 | PF02863.20 | 0.79 | 22 | 2978.0 | same-strand | Arginine repressor, C-terminal domain |